Exploring the influence of online reviews and motivating factors on sales: A meta-analytic study and the moderating role of product category

Li K, Chen Y, Zhang L, (2020), Exploring the influence of online reviews and motivating factors on sales: A meta-analytic study and the moderating role of product category, Journal of Retailing and Consumer Services, Volume 55, July 2020, 102107

https://www.sciencedirect.com/science/article/abs/pii/S0969698919304011

Mots clés : Avis en ligne, Facteurs motivants, Ventes de produits, Catégorie de produit, Méta-analyse, Effet modérateur

Résumé : Les avis en ligne, qui influencent considérablement les ventes de produits, ont été un sujet de recherche central dans le domaine du marketing. Pendant ce temps, certains facteurs de motivation liés aux détaillants en ligne ont été liés aux ventes de produits. Alors que plusieurs articles ont examiné l’impact entre les critiques en ligne et les facteurs de motivation sur les ventes de produits, de nombreuses conclusions tirées sont contradictoires. À partir de 28 études axées sur les avis et les ventes en ligne, cette étude effectue une méta-analyse pour analyser les véritables impacts de six facteurs liés aux avis (c.-à-d. Le nombre d’avis, le nombre d’étoiles, l’écart-type des notes, l’utilité, la durée de l’avis et le sentiment) et deux facteurs de motivation (c.-à-d. rabais sur les prix et expédition spéciale) sur les ventes de produits. Pendant ce temps, ce document étudie également comment un facteur lié au produit (c.-à-d. L’âge du produit) et un facteur lié aux examinateurs (i. e., la réputation de l’examinateur) influencent la relation entre les avis en ligne et les ventes de produits. De plus, pour étudier l’effet modérateur de la catégorie de produits, nous divisons la littérature sélectionnée en deux sous-groupes qui sont des produits de recherche et d’expérience. Les résultats indiquent que seules la longueur de l’examen et l’expédition spéciale n’ont pas d’impact significatif sur les ventes de produits, tandis que la catégorie de produit a un effet modérateur valide et spécifique sur la relation entre ces déterminants et les ventes. Les conclusions présentées auront des implications importantes pour la recherche universitaire et les futures pratiques de l’industrie. Nous divisons la littérature sélectionnée en deux sous-groupes qui sont des produits de recherche et d’expérience. Les résultats indiquent que seule la durée de l’examen et l’expédition spéciale n’ont pas d’impact significatif sur les ventes de produits, tandis que la catégorie de produit a un effet modérateur valide et spécifique sur la relation entre ces déterminants et les ventes. Les conclusions présentées auront des implications importantes pour la recherche universitaire et les futures pratiques de l’industrie. Nous divisons la littérature sélectionnée en deux sous-groupes qui sont des produits de recherche et d’expérience. Les résultats indiquent que seules la durée de l’examen et l’expédition spéciale n’ont pas d’impact significatif sur les ventes de produits, tandis que la catégorie de produit a un effet modérateur valide et spécifique sur la relation entre ces déterminants et les ventes. Les conclusions présentées auront des implications importantes pour la recherche universitaire et les futures pratiques de l’industrie.


Archak, N., Ghose, A., Ipeirotis, P.G., 2011. Deriving the pricing power of product
features by mining consumer reviews. Manag. Sci. 57, 1485–1509.
Artursson, E., 2015. Online Ratings–Who Decides what Games You Buy. Master Thesis in
Economics. Lunds Universitet.
Babi�c Rosario, A., Sotgiu, F., De Valck, K., Bijmolt, T.H.A., 2016. The effect of electronic
word of mouth on sales: A meta-analytic review of platform, product, and metric
factors. J. Mark. Res 53 (3), 297–318.
Bao, T., Chang, T.S., 2014a. Finding disseminators via electronic word of mouth message
for effective marketing communications. Decis. Support Syst. 67, 21–29.
Bao, T., Chang, T.S., 2014b. Why Amazon uses both the New York Times Best Seller List
and customer reviews: an empirical study of multiplier effects on product sales from
multiple earned media. Decis. Support Syst. 67, 1–8.
Blundell, M., 2014. Understanding and synthesizing my numerical data. A. Boland, M.G.
Cherry, R. Dickson (Eds.), Doing a Syst. Rev. Sage, London, UK 99–123.
Bosman, D.J., Boshoff, C., Van Rooyen, G.-J., 2013. The review credibility of electronic
word-of-mouth communication on e-commerce platforms. Manag. Dyn. J. South.
Afr. Inst. Manag. Sci. 22, 29–44.
Caballero, L., 2015. The Impact of Online Ratings on Video Game Sales. Master Thesis in
Management. Nova School of Business and Economics.
Chatterjee, P., 2001. Online Reviews: Do Consumers Use Them?.
Chen, K., Luo, P., Wang, H., 2017. An influence framework on product word-of-mouth
(WoM) measurement. Inf. Manag. 54, 228–240.
Chen, P.-Y., Dhanasobhon, S., Smith, M.D., 2008. All reviews are not created equal: the
disaggregate impact of reviews and reviewers at amazon. com, Working paper,
Carnegie Mellon University. Available at: SSRN. https://ssrn.com/abstract¼918083.
https://doi.org/10.2139/ssrn.918083.
Chen, P.-Y., Wu, S., Yoon, J., 2004. The impact of online recommendations and consumer
feedback on sales. In: International Conference on Information Systems (ICIS),
pp. 711–724.
Chen, Y., Xie, J., 2008. Online consumer review: word-of-mouth as a new element of
marketing communication mix. Manag. Sci. 54, 477–491.
Cho, Y., Im, I., Hiltz, R., Fjermestad, J., 2002. An analysis of online customer complaints:
implications for web complaint management. In: Proceedings of the 35th Annual
Hawaii International Conference on System Sciences. IEEE, Hawaii, pp. 2308–2317.
Clemons, E.K., Gao, G.G., Hitt, L.M., 2006. When online reviews meet
hyperdifferentiation: a study of the craft beer industry. J. Manag. Inf. Syst. 23,
149–171.
Cui, G., Lui, H.-K., Guo, X., 2012. The effect of online consumer reviews on new product
sales. Int. J. Electron. Commer. 17, 39–58.
Cui, J., Pan, Y., Wang, L., 2012b. Impact of online review on sales: an empirical
investigation of experience products with different popularities. In: 2012
International Conference on Management of E-Commerce and E-Government. IEEE,
pp. 48–53.
DerSimonian, R., Kacker, R., 2007. Random-effects model for meta-analysis of clinical
trials: an update. Contemp. Clin. Trials 28, 105–114.
Dixit, S., Badgaiyan, A.J., Khare, A., 2019. An integrated model for predicting
consumer’s intention to write online reviews. J. Retailing Consum. Serv. 46,
112–120.
Duan, W., Gu, B., Whinston, A.B., 2008. Do online reviews matter?—an empirical
investigation of panel data. Decis. Support Syst. 45, 1007–1016.
Dwivedi, Y.K., Rana, N.P., Chen, H., Williams, M.D., 2011. A meta-analysis of the unified
theory of acceptance and use of technology (UTAUT). In: IFIP International Working
Conference on Governance and Sustainability in Information Systems-Managing the
Transfer and Diffusion of it. Springer, pp. 155–170.
Ehrmann, T., Schmale, H., 2008. The hitchhiker’s guide to the long tail: the influence of
online-reviews and product recommendations on book sales-Evidence from German
online retailing. In: International Conference on Information Systems, p. 157.
Eliashberg, J., Sawhney, M.S., 1994. Modeling goes to Hollywood: predicting individual
differences in movie enjoyment. Manag. Sci. 40, 1151–1173.
Fang, H., Zhang, J., Bao, Y., Zhu, Q., 2013. Towards effective online review systems in
the Chinese context: a cross-cultural empirical study. Electron. Commer. Res. Appl.
12, 208–220.
Field, A.P., 2001. Meta-analysis of correlation coefficients: a Monte Carlo comparison of
fixed-and random-effects methods. Psychol. Methods 6, 161.
Firth, J., Torous, J., Nicholas, J., Carney, R., Pratap, A., Rosenbaum, S., Sarris, J., 2017.
The efficacy of smartphone-based mental health interventions for depressive
symptoms: a meta-analysis of randomized controlled trials. World Psychiatr. 16,
287–298.
Fleiss, J.L., 1993. Review papers: the statistical basis of meta-analysis. Stat. Methods
Med. Res. 2, 121–145.
Floyd, K., Freling, R., Alhoqail, S., Cho, H.Y., Freling, T., 2014. How online product
reviews affect retail sales: a meta-analysis. J. Retailing 90, 217–232.
Forman, C., Ghose, A., Wiesenfeld, B., 2008. Examining the relationship between reviews
and sales: the role of reviewer identity disclosure in electronic markets. Inf. Syst. Res.
19, 291–313.
Franke, G.R., Huhmann, B.A., Mothersbaugh, D.L., 2004. Information content and
consumer readership of print ads: a comparison of search and experience products.
J. Acad. Market. Sci. 32, 20–31.
Girard, T., Dion, P., 2010. Validating the search, experience, and credence product
classification framework. J. Bus. Res. 63, 1079–1087.
Glass, G.V., 1976. Primary, secondary, and meta-analysis of research. Educ. Res. 5, 3–8.
Gu, B., Park, J., Konana, P., 2012. Research note—the impact of external word-of-mouth
sources on retailer sales of high-involvement products. Inf. Syst. Res. 23, 182–196.
Gu, B., Tang, Q., Whinston, A.B., 2013. The influence of online word-of-mouth on long
tail formation. Decis. Support Syst. 56, 474–481.
Gurevitch, J., Koricheva, J., Nakagawa, S., Stewart, G., 2018. Meta-analysis and the
science of research synthesis. Nature 555, 175–182.
Hellofs, L.L., Jacobson, R., 1999. Market share and customers’ perceptions of quality:
when can firms grow their way to higher versus lower quality? J. Market. 63, 16–25.
Herrmann, A., Huber, F., Coulter, R.H., 1997. Product and service bundling decisions and
their effects on purchase intention. Pricing Strategy & Pract. 5 (3), 99–104.
Hong, H., Xu, D., Wang, G.A., Fan, W., 2017. Understanding the determinants of online
review helpfulness: a meta-analytic investigation. Decis. Support Syst. 102, 1–11.
Hu, N., Bose, I., Koh, N.S., Liu, L., 2012. Manipulation of online reviews: an analysis of
ratings, readability, and sentiments. Decis. Support Syst. 52, 674–684.
Hu, N., Koh, N.S., Reddy, S.K., 2014. Ratings lead you to the product, reviews help you
clinch it? The mediating role of online review sentiments on product sales. Decis.
Support Syst. 57, 42–53.
Hu, N., Liu, L., Zhang, J.J., 2008. Do online reviews affect product sales? The role of
reviewer characteristics and temporal effects. Inf. Technol. Manag. 9, 201–214.
Jiang, B.-J., Wang, B., 2008. Impact of consumer reviews and ratings on sales, prices, and
profits: theory and evidence. In: International Conference on Information Systems,
p. 141.
Jim�enez, F.R., Mendoza, N.A., 2013. Too popular to ignore: the influence of online
reviews on purchase intentions of search and experience products. J. Interact.
Market. 27, 226–235.
Kim, J.B., 2014. Impact of online customer reviews and incentives on the product sales at
the online retail store: an empirical study at Amazon. com. In: Twentieth Americas
Conference on Information Systems, pp. 1–11.
King, W.R., He, J., 2006. A meta-analysis of the technology acceptance model. Inf.
Manag. 43, 740–755.
Lau, R.Y.K., Zhang, W., Bruza, P.D., Wong, K.-F., 2011. Learning domain-specific
sentiment lexicons for predicting product sales. In: 2011 IEEE 8th International
Conference on E-Business Engineering. IEEE, pp. 131–138.
Lee, J., Park, D.-H., Han, I., 2008. The effect of negative online consumer reviews on
product attitude: an information processing view. Electron. Commer. Res. Appl. 7,
341–352.
Lee, T.Y., Bradlow, E.T., 2011. Automated marketing research using online customer
reviews. J. Market. Res. 48, 881–894.
Li, H., Fang, Y., Wang, Y., Lim, K.H., Liang, L., 2015. Are all signals equal? Investigating
the differential effects of online signals on the sales performance of e-marketplace
sellers. Inf. Technol. People 28, 699–723.
Li, X., Hitt, L.M., 2010. Price effects in online product reviews: an analytical model and
empirical analysis. MIS Q. 809–831.
Li, X., Hitt, L.M., 2008. Self-selection and information role of online product reviews. Inf.
Syst. Res. 19, 456–474.
Li, X., Wu, C., Mai, F., 2019. The effect of online reviews on product sales: a joint
sentiment-topic analysis. Inf. Manag. 56, 172–184.
Lim, C., 1999. A meta-analytic review of international tourism demand. J. Trav. Res. 37,
273–284.
Lin, Z., 2014. An empirical investigation of user and system recommendations in ecommerce. Decis. Support Syst. 68, 111–124.
Lipsey, M.W., Wilson, D.B., 2001. Practical Meta-Analysis. Sage Publications, Inc.
Liu, Q., Huang, S., Zhang, L., 2016. The influence of information cascades on online
purchase behaviors of search and experience products. Electron. Commer. Res. 16,
553–580.
Liu, Q., Zhang, X., Zhang, L., Zhao, Y., 2018. The interaction effects of information
cascades, word of mouth and recommendation systems on online reading behavior:
an empirical investigation. Electron. Commer. Res. 1–27 https://doi.org/10.1007/
s10660-018-9312-0.
Maslowska, E., Malthouse, E.C., Bernritter, S.F., 2017. The effect of online customer
reviews’ characteristics on sales. In: Advances in Advertising Research, vol. VII.
Springer, pp. 87–100.
Meiseberg, B., 2016. The effectiveness of e-tailers’ communication practices in
stimulating sales of niche versus popular products. J. Retailing 92, 319–332.
K. Li et al.
Journal of Retailing and Consumer Services 55 (2020) 102107
11
Meng, Y., Wang, H., Zheng, L., 2018. Impact of online word-of-mouth on sales: the
moderating role of product review quality. New Rev. Hypermedia Multimedia 24,
1–27.
Moe, W., 2009. How Much Does a Good Product Rating Help a Bad Product? Modeling
the Role of Product Quality in the Relationship between Online Consumer Ratings
and Sales, Working Paper. University Of Maryland College Park.
Monroe, K.B., 2003. Pricing: Making Profitable Decisions, third ed. McGraw Hill Book
Company, New York.
Moon, S., Park, Y., Seog Kim, Y., 2014. The impact of text product reviews on sales. Eur.
J. Market. 48, 2176–2197.
Mudambi, S.M., Schuff, D., 2010. What makes a helpful online review? A study of
customer reviews on Amazon. com. MIS Q. 34, 185–200.
Nelson, P., 1974. Advertising as information. J. Polit. Econ. 82, 729–754.
Park, C., Lee, T.M., 2009. Information direction, website reputation and eWOM effect: a
moderating role of product type. J. Bus. Res. 62, 61–67.
Park, C.W., Stice, E.K., 2000. Analyst forecasting ability and the stock price reaction to
forecast revisions. Rev. Account. Stud. 5, 259–272.
Park, D.-H., Lee, J., Han, I., 2007. The effect of on-line consumer reviews on consumer
purchasing intention: the moderating role of involvement. Int. J. Electron. Commer.
11, 125–148.
Purnawirawan, N., Eisend, M., De Pelsmacker, P., Dens, N., 2015. A meta-analytic
investigation of the role of valence in online reviews. J. Interact. Market. 31, 17–27.
Ren, J., Nickerson, J.V., 2019. Arousal, valence, and volume: how the influence of online
review characteristics differs with respect to utilitarian and hedonic products. Eur. J.
Inf. Syst. 28, 272–290.
Rese, A., Schreiber, S., Baier, D., 2014. Technology acceptance modeling of augmented
reality at the point of sale: can surveys be replaced by an analysis of online reviews?
J. Retailing Consum. Serv. 21, 869–876.
Rosenthal, R., 1986. Meta-analytic procedures for social science research. Educ. Res. 15,
18–20.
Sahoo, N., Srinivasan, S., Dellarocas, C., 2013. The impact of online product reviews on
product returns and net sales. In: 2013 Workshop on Information Systems
Economics, Milan, Italy.
Schubert, P., Ginsburg, M., 2000. Virtual communities of transaction: the role of
personalization in electronic commerce. Electron. Mark. 10, 45–55.
Sparks, B.A., Browning, V., 2011. The impact of online reviews on hotel booking
intentions and perception of trust. Tourism Manag. 32, 1310–1323.
Tang, T., Fang, E., Wang, F., 2014. Is neutral really neutral? The effects of neutral usergenerated content on product sales. J. Market. 78, 41–58.
Weisstein, F.L., Song, L., Andersen, P., Zhu, Y., 2017. Examining impacts of negative
reviews and purchase goals on consumer purchase decision. J. Retailing Consum.
Serv. 39, 201–207.
Wu, J., Du, L., Dang, Y., 2018. Research on the impact of consumer review sentiments
from different websites on product sales. In: 2018 IEEE International Conference on
Software Quality, Reliability and Security Companion (QRS-C). IEEE, pp. 332–338.
Yan, J., Zhang, Li, Zhang, Lei, 2012. An empirical study of the impact of review content
on online reviews helpfulness in e-commerce. Inf. Sci. 30, 713–718.
Yang, Y., Park, S., Hu, X., 2018. Electronic word of mouth and hotel performance: a
meta-analysis. Tourism Manag. 67, 248–260. https://doi.org/10.1016/j.
tourman.2018.01.015.
Yao, R., Chen, J., 2013. Predicting movie sales revenue using online reviews. In: 2013
IEEE International Conference on Granular Computing (GrC). IEEE, pp. 396–401.
Ye, Q., Law, R., Gu, B., Chen, W., 2011. The influence of user-generated content on
traveler behavior: an empirical investigation on the effects of e-word-of-mouth to
hotel online bookings. Comput. Hum. Behav. 27, 634–639.
Ye, Y., Zhao, Y., Shang, J., Zhang, L., 2019. A hybrid IT framework for identifying highquality physicians using big data analytics. Int. J. Inf. Manag. 47, 65–75.
You, Y., Vadakkepatt, G.G., Joshi, A.M., 2015. A meta-analysis of electronic word-ofmouth elasticity. J. Market. 79, 19–39.
Zhang, L., Ma, B., Cartwright, D.K., 2013. The impact of online user reviews on cameras
sales. Eur. J. Market. 47, 1115–1128.
Zhang, L., Zhu, J., Liu, Q., 2012. A meta-analysis of mobile commerce adoption and the
moderating effect of culture. Comput. Hum. Behav. 28, 1902–1911.
Zhao, Y., Ni, Q., Zhou, R., 2018. What factors influence the mobile health service
adoption? A meta-analysis and the moderating role of age. Int. J. Inf. Manag. 43,
342–350.
Zhu, F., Zhang, X., 2010. Impact of online consumer reviews on sales: the moderating
role of product and consumer characteristics. J. Market. 74, 133–148.
Zhu, L., Yin, G., He, W., 2014. Is this opinion leader’s review useful? Peripheral cues for
online review helpfulness. J. Electron. Commer. Res. 15, 267.

Credibility of negative online product reviews: Reviewer gender, reputation and emotion effects

Craciun G, Moore K, (2019), Credibility of negative online product reviews: Reviewer gender, reputation and emotion effects, Computers in Human Behavior, Volume 97, August 2019, Pages 104-115

https://www.sciencedirect.com/science/article/pii/S0747563219301025

Mots clés : Bouche à oreille électronique, Stéréotypes de genre, Émotion, Crédibilité de l’examinateur, Avis sur les produits, Expressions émotionnelles, Théorie de l’espérance linguistique

Résumé : La documentation électronique sur le bouche-à-oreille confirme la conclusion solide selon laquelle les avis négatifs influencent généralement plus le comportement des consommateurs que les avis positifs. De plus, des études récentes suggèrent qu’une grande partie du biais de négativité est motivée par les émotions distinctes intégrées dans le contenu du bouche à oreille négatif  et les effets d’interaction entre les émotions et d’autres facteurs sources. Bien que le sexe de la source d’information soit une heuristique courante utilisée dans l’évaluation des messages, il s’agit de la première étude à examiner l’effet des stéréotypes de genre sur le bouche à oreille émotionnel. Deux expériences basées sur le Web montrent que lorsque des indices de réputation de critique sont présents, le contenu émotionnel dans le bouche à oreille négatif diminue la crédibilité des critiques masculins et l’utilité de leurs critiques, mais n’affecte pas les critiques rédigées par des femmes. En revanche, lorsque les indices de réputation sont absents, la présence d’émotions dans le bouche à oreille négatif diminue la crédibilité des examinateurs féminins, mais pas celle des examinateurs masculins. L’indice de réputation a un effet positif sur la crédibilité et l’utilité du bouche à oreille négatif.

Grandes lignes :

  • Le bouche-à-oreille négatif influe généralement davantage sur le comportement des consommateurs que le bouche-à-oreille positif.
  • Cette étude examine les effets de la réputation et des stéréotypes liés au sexe sur la crédibilité et l’utilité du bouche-à-oreille négatif
  • Lorsque les indices de réputation des évaluateurs étaient absents, le contenu émotionnel du bouche-à-oreille négatif a nui à l’évaluation des critiques rédigées par des femmes
  • Lorsque les indices de réputation des examinateurs étaient présents, le contenu émotionnel du bouche-à-oreille négatif a nui à l’évaluation des critiques rédigées par des hommes.
  • L’indice de réputation a eu un effet positif sur la crédibilité et l’utilité du bouche-à-oreille négatif.

Afifi, W. A., & Metts, S. (1998). Characteristics and consequences of expectation violations in close relationships. Journal of Social and Personal Relationships, 15(3),
365–392. https://doi.org/10.1177/0265407598153004.
Ahmad, S. N., & Laroche, M. (2015). How do expressed emotions affect the helpfulness of
a product review? Evidence from reviews using latent semantic analysis. International
Journal of Electronic Commerce, 20(1), 76–111. https://doi.org/10.1080/10864415.
2016.1061471.
Armstrong, C. L., & McAdams, M. J. (2009). Blogs of information: How gender cues and
individual motivations influence perceptions of credibility. Journal of ComputerMediated Communication, 14(3), 435–456. https://doi.org/10.1111/j.1083-6101.
2009.01448.x.
Armstrong, C. L., & Nelson, M. R. (2005). How newspaper sources trigger gender stereotypes. Journalism & Mass Communication Quarterly, 82(4), 820–837.
Averbeck, J. M., & Miller, C. (2014). Expanding language expectancy theory: The suasory
effects of lexical complexity and syntactic complexity on effective message design.
Communication Studies, 65(1), 72–95. https://doi.org/10.1080/10510974.2013.
775955.
Baek, H., Ahn, J., & Choi, Y. (2012). Helpfulness of online consumer reviews: Readers’
G. Craciun and K. Moore Computers in Human Behavior 97 (2019) 104–115
113
objectives and review cues. International Journal of Electronic Commerce, 17(2),
99–126. https://doi.org/10.2753/JEC1086-4415170204.
Biernat, M. (2003). Toward a broader view of social stereotyping. American Psychologist,
58(12), 1019–1027. https://doi.org/10.1037/0003-066X.58.12.1019.
Biernat, M., Crandall, C. S., Young, L. V., Kobrynowicz, D., & Halpin, S. M. (1998). All that
you can be: Stereotyping of self and others in a military context. Journal of Personality
and Social Psychology, 75(2), 301–317. https://doi.org/10.1037/0022-3514.75.2.
301.
Biernat, M., Ma, J. E., & Nario-Redmond, M. R. (2008). Standards to suspect and diagnose
stereotypical traits. Social Cognition, 26(3), 288–313.
Brescoll, V. L., & Uhlmann, E. L. (2008). Can an angry woman get ahead? Status conferral,
gender, and expression of emotion in the workplace. Psychological Science, 19(3),
268–275. https://doi.org/10.1111/j.1467-9280.2008.02079.x.
Brody, L. R., & Hall, J. A. (1993). Gender and emotion. Handbook of emotions (pp. 447–
460). New York, NY, US: Guilford Press.
Brown, J. J., & Reingen, P. H. (1987). Social ties and word-of-mouth referral behavior.
Journal of Consumer Research, 14(3), 350–362. https://doi.org/10.1086/209118.
Brucks, M. (1985). The effects of product class knowledge on information search behavior. Journal of Consumer Research, 12(1), 1–16.
Burgoon, M., Birk, T. S., & Hall, J. R. (1991). Compliance and satisfaction with physicianpatient communication. An expectancy theory interpretation of gender differences.
Human Communication Research, 18(2), 177–208. https://doi.org/10.1111/j.1468-
2958.1991.tb00543.x.
Burgoon, M., Denning, V. P., & Roberts, L. (2002). Language expectancy theory. In J. P.
Dillard, & M. Pfau (Eds.). The persuasion handbook : Developments in theory and practice
(pp. 117–136). Thousand Oaks, CA: Sage Publications.
Burgoon, M., Jones, S. B., & Stewart, D. (1975). Toward a message-centered theory of
persuasion: Three empirial investigations of language intensity. Human
Communication Research, 1(3), 240–256. https://doi.org/10.1111/j.1468-2958.1975.
tb00271.x.
Buttner, E. H., & McEnally, M. (1996). The interactive effect of influence tactic, applicant
gender, and type of job on hiring recommendations. Sex Roles, 34(7–8), 581–591.
Cao, Q., Duan, W., & Gan, Q. (2011). Exploring determinants of voting for the ‘helpfulness’ of online user reviews: A text mining approach. Decision Support Systems,
50(2), 511–521. https://doi.org/10.1016/j.dss.2010.11.009.
Carli, L. L. (2001). Gender and social influence. Journal of Social Issues, 57(4), 725.
Carpenter, S., & Trentham, S. (1998). Subtypes of women and men: A new taxonomy and
an exploratory categorical analysis. Journal of Social Behavior & Personality, 13(4),
679–696.
Casler, K., Bickel, L., & Hackett, E. (2013). Separate but equal? A comparison of participants and data gathered via amazon’s MTurk, social media, and face-to-face behavioral testing. Computers in Human Behavior, 29(6), 2156–2160. https://doi.org/
10.1016/j.chb.2013.05.009.
Chai, S., Das, S., & Rao, H. R. (2011). Factors affecting bloggers’ knowledge sharing: An
investigation across gender. Journal of Management Information Systems, 28(3),
309–342.
Chaiken, S. (1980). Heuristic versus systematic information processing and the use of
source versus message cues in persuasion. Journal of Personality and Social Psychology,
39(5), 752–766.
Chaiken, S., & Maheswaran, D. (1994). Heuristic processing can bias systematic processing: Effects of source credibility, argument ambiguity, and task importance on attitude judgment. Journal of Personality and Social Psychology, 66(3), 460–473. https://
doi.org/10.1037/0022-3514.66.3.460.
Chakravarty, A., Liu, Y., & Mazumdar, T. (2010). The differential effects of online wordof-mouth and critics’ reviews on pre-release movie evaluation. Journal of Interactive
Marketing, 24(3), 185–197. https://doi.org/10.1016/j.intmar.2010.04.001.
Chen, G. M., & Abedin, Z. (2014). Exploring differences in how men and women respond
to threats to positive face on social media. Computers in Human Behavior, 38,
118–126. https://doi.org/10.1016/j.chb.2014.05.029.
Cheung, C. M. K., Lee, M. K. O., & Rabjohn, N. (2008). The impact of electronic word‐of‐mouth: The adoption of online opinions in online customer communities. Internet
Research, 18(3), 229–247. https://doi.org/10.1108/10662240810883290.
Chevalier, J. A., & Mayzlin, D. (2006). The effect of word of mouth on sales: Online book
reviews. Journal of Marketing Research, 43(3), 345–354. https://doi.org/10.1509/
jmkr.43.3.345.
Chua, A. Y. K., & Banerjee, S. (2015). Understanding review helpfulness as a function of
reviewer reputation, review rating, and review depth. Journal of the Association for
Information Science and Technology, 66(2), 354–362. https://doi.org/10.1002/asi.
23180.
Chu, S.-C., & Kim, Y. (2011). Determinants of consumer engagement in electronic wordof-mouth (eWOM) in social networking sites. International Journal of Advertising,
30(1), 47–75. https://doi.org/10.2501/IJA-30-1-047-075.
Clemons, E. K., Gao, G. G., & Hitt, L. M. (2006). When online reviews meet hyperdifferentiation: A study of the craft beer industry. Journal of Management
Information Systems, 23(2), 149–171. https://doi.org/10.2753/MIS0742-
1222230207.
Cotterill, S. T. (2018). The psychology of performance. London: Routledge.
Deaux, K., & Lewis, L. L. (1984). Structure of gender stereotypes: Interrelationships
among components and gender label. Journal of Personality and Social Psychology,
46(5), 991–1004. https://doi.org/10.1037/0022-3514.46.5.991.
Derks, D., Bos, A. E. R., & von Grumbkow, J. (2007). Emoticons and social interaction on
the Internet: The importance of social context. Computers in Human Behavior, 23(1),
842–849. https://doi.org/10.1016/j.chb.2004.11.013.
Dou, X., Walden, J. A., Lee, S., & Lee, J. Y. (2012). Does source matter? Examining source
effects in online product reviews. Computers in Human Behavior, 28(5), 1555–1563.
https://doi.org/10.1016/j.chb.2012.03.015.
Eckes, T. (2002). Paternalistic and envious gender stereotypes: Testing predictions from
the stereotype content model. Sex Roles, 47(3/4), 99–114.
Fabes, R.,A., & Martin, C. L. (1991). Gender and age stereotypes of emotionality.
Personality and Social Psychology Bulletin, 17(5), 532–540. https://doi.org/10.1177/
0146167291175008.
Felix, R., Rauschnabel, P. A., & Hinsch, C. (2017). Elements of strategic social media
marketing: A holistic framework. Journal of Business Research, 70, 118–126. https://
doi.org/10.1016/j.jbusres.2016.05.001.
Filieri, R. (2015). What makes online reviews helpful? A diagnosticity-adoption framework to explain informational and normative influences in e-WOM. Journal of
Business Research, 68(6), 1261–1270. https://doi.org/10.1016/j.jbusres.2014.11.
006.
Fiske, S. T. (1993). Social cognition and social perception. Annual Review of Psychology,
44(1), 155–194. https://doi.org/10.1146/annurev.ps.44.020193.001103.
Folse, J. A. G., Porter, M., III, Godbole, M. B., & Reynolds, K. E. (2016). The effects of
negatively valenced emotional expressions in online reviews on the reviewer, the
review, and the product. Psychology and Marketing, 33(9), 747–760. https://doi.org/
10.1002/mar.20914.
Ford, J. B. (2017). Amazon’s mechanical Turk: A comment. Journal of Advertising, 46(1),
156–158. https://doi.org/10.1080/00913367.2016.1277380.
Forman, C., Ghose, A., & Wiesenfeld, B. (2008). Examining the relationship between
reviews and sales: The role of reviewer identity disclosure in electronic markets.
Information Systems Research, 19(3), 291–313. https://doi.org/10.1287/isre.1080.
0193.
Gershoff, A. D., Broniarczyk, S. M., & West, P. M. (2001). Recommendation or evaluation?
Task sensitivity in information source selection. Journal of Consumer Research, 28(3),
418–438. https://doi.org/10.1086/323730.
Guo, B., & Zhou, S. (2017). What makes population perception of review helpfulness: An
information processing perspective. Electronic Commerce Research, 17(4), 585–608.
https://doi.org/10.1007/s10660-016-9234-7.
Hess, U., Adams, R. B., Jr., & Kleck, R. E. (2007). When two do the same, it might not
mean the same: The perception of emotional expressions shown by men and women.
In U. Hess, P. Philippot, U. Hess, & P. Philippot (Eds.). Group dynamics and emotional
expression (pp. 33–50). New York, NY, US: Cambridge University Press.
Hess, U., Senécal, S., Kirouac, G., Herrera, P., Philippot, P., & Kleck, R. E. (2000).
Emotional expressivity in men and women: Stereotypes and self-perceptions.
Cognition & Emotion, 14(5), 609–642. https://doi.org/10.1080/
02699930050117648.
Hong, H., Xu, D., Wang, G. A., & Fan, W. (2017). Understanding the determinants of
online review helpfulness: A meta-analytic investigation. Decision Support Systems,
102, 1–11. https://doi.org/10.1016/j.dss.2017.06.007.
Jansen, J. (2010). Online product research. Retrieved from: http://pewinternet.org/
Reports/2010/Online-Product-Research.aspx.
Jensen, M. L., Averbeck, J. M., Zhang, Z., & Wright, K. B. (2013). Credibility of anonymous online product reviews: A language expectancy perspective. Journal of
Management Information Systems, 30(1), 293–324. https://doi.org/10.2753/MIS0742-
1222300109.
Kang, Y. S., & Herr, P. M. (2006). Beauty and the beholder: Toward an integrative model
of communication source effects. Journal of Consumer Research, (1), 123. https://doi.
org/10.1086/504143.
Kees, J., Berry, C., Burton, S., & Sheehan, K. (2017). An analysis of data quality:
Professional panels, student subject pools, and Amazon’s Mechanical Turk. Journal of
Advertising, 46(1), 141–155. https://doi.org/10.1080/00913367.2016.1269304.
Kim, J., & Gupta, P. (2012). Emotional expressions in online user reviews: How they
influence consumers’ product evaluations. Journal of Business Research, 65(7),
985–992. https://doi.org/10.1016/j.jbusres.2011.04.013.
Kim, S., Kandampully, J., & Bilgihan, A. (2018). The influence of eWOM communications:
An application of online social network framework. Computers in Human Behavior, 80,
243–254. https://doi.org/10.1016/j.chb.2017.11.015.
Kim, S. J., Maslowska, E., & Malthouse, E. C. (2017). Understanding the effects of different review features on purchase probability. International Journal of Advertising,
1–25. https://doi.org/10.1080/02650487.2017.1340928.
Kim, S. J., Wang, R. J.-H., Maslowska, E., & Malthouse, E. C. (2016). “Understanding a
fury in your words”: The effects of posting and viewing electronic negative word-ofmouth on purchase behaviors. Computers in Human Behavior, 54, 511–521. https://
doi.org/10.1016/j.chb.2015.08.015.
Kuan, K. K. Y., Kai-Lung, H., Prasarnphanich, P., & Hok-Yin, L. (2015). What makes a
review voted? An empirical investigation of review voting in online review systems.
Journal of the Association for Information Systems, 16(1), 48–71.
Lee, D.-H., Im, S., & Taylor, C. R. (2008). Voluntary self-disclosure of information on the
Internet: A multimethod study of the motivations and consequences of disclosing
information on blogs. Psychology and Marketing, 25(7), 692–710.
Li, M., Huang, L., Tan, C.-H., & Wei, K.-K. (2013). Helpfulness of online product reviews
as seen by consumers: Source and content features. International Journal of Electronic
Commerce, 17(4), 101–136. https://doi.org/10.2753/JEC1086-4415170404.
Ludwig, S., de Ruyter, K., Friedman, M., Brüggen, E. C., Wetzels, M., & Pfann, G. (2013).
More than words: The influence of affective content and linguistic style matches in
online reviews on conversion rates. Journal of Marketing, 77(1), 87–103. https://doi.
org/10.1509/jm.11.0560.
Mittal, B. (1995). A comparative analysis of four scales of consumer involvement.
Psychology and Marketing, 12(7), 663–682.
Pan, L.-Y., & Chiou, J.-S. (2011). How much can you trust online information? Cues for
perceived trustworthiness of consumer-generated online information. Journal of
Interactive Marketing, 25(2), 67–74. https://doi.org/10.1016/j.intmar.2011.01.002.
Pan, Y., & Zhang, J. Q. (2011). Born unequal: A study of the helpfulness of user-generated
product reviews. Journal of Retailing, 87(4), 598–612. https://doi.org/10.1016/j.
G. Craciun and K. Moore Computers in Human Behavior 97 (2019) 104–115
114
jretai.2011.05.002.
Park, D.-H., & Lee, J. (2008). eWOM overload and its effect on consumer behavioral
intention depending on consumer involvement. Electronic Commerce Research and
Applications, 7(4), 386–398. https://doi.org/10.1016/j.elerap.2007.11.004.
Park, C., & Lee, T. M. (2009). Information direction, website reputation and eWOM effect:
A moderating role of product type. Journal of Business Research, 62(1), 61–67. https://
doi.org/10.1016/j.jbusres.2007.11.017.
Peer, E., Brandimarte, L., Samat, S., & Acquisti, A. (2017). Beyond the Turk: Alternative
platforms for crowdsourcing behavioral research. Journal of Experimental Social
Psychology, 70, 153–163. https://doi.org/10.1016/j.jesp.2017.01.006.
Quaschning, S., Pandelaere, M., & Vermeir, I. (2015). When consistency matters: The
effect of valence consistency on review helpfulness. Journal of Computer-Mediated
Communication, 20(2), 136–152. https://doi.org/10.1111/jcc4.12106.
Rauschnabel, P. A., Kammerlander, N., & Ivens, B. S. (2016). Collaborative brand attacks
in social media: Exploring the antecedents, characteristics, and consequences of a
new form of brand crises. Journal of Marketing Theory and Practice, 24(4), 381–410.
https://doi.org/10.1080/10696679.2016.1205452.
Richins, M. L. (1997). Measuring emotions in the consumption experience. Journal of
Consumer Research, 24(2), 127–146.
Rogers, E. M. (1995). Diffusion of innovations (4 ed.). New York, NY: The Free Press.
Salerno, J. M., & Peter-Hagene, L. C. (2015). One angry woman: Anger expression increases influence for men, but decreases influence for women, during group deliberation. Law and Human Behavior, 39(6), 581–592. https://doi.org/10.1037/
lhb0000147.
Schellekens, G. A. C., Verlegh, P. W. J., & Smidts, A. (2010). Language abstraction in word
of mouth. Journal of Consumer Research, 37(2), 207–223.
Schlosser, A. E., White, T. B., & Lloyd, S. M. (2006). Converting web site visitors into
buyers: How web site investment increases consumer trusting beliefs and online
purchase intentions. Journal of Marketing, 70(2), 133–148. https://doi.org/10.1509/
jmkg.70.2.133.
Sen, S., & Lerman, D. (2007). Why are you telling me this? An examination into negative
consumer reviews on the web. Journal of Interactive Marketing, 21(4), 76–94. https://
doi.org/10.1002/dir.20090.
Shin, D. (2018). Empathy and embodied experience in virtual environment: To what
extent can virtual reality stimulate empathy and embodied experience? Computers in
Human Behavior, 78, 64–73. https://doi.org/10.1016/j.chb.2017.09.012.
Shin, D., & Biocca, F. (2018). Exploring immersive experience in journalism. New Media &
Society, 20(8), 2800–2823. https://doi.org/10.1177/1461444817733133.
Shin, D., Lee, S., & Hwang, Y. (2017). How do credibility and utility play in the user
experience of health informatics services? Computers in Human Behavior, 67,
292–302. https://doi.org/10.1016/j.chb.2016.11.007.
Sparks, B. A., & Browning, V. (2011). The impact of online reviews on hotel booking
intentions and perception of trust. Tourism Management, 32(6), 1310–1323. https://
doi.org/10.1016/j.tourman.2010.12.011.
Stout, J. G., Grunberg, V. A., & Ito, T. A. (2016). Gender roles and stereotypes about
science sareers help explain women and men’s science pursuits. Sex Roles, 75(9–10),
490–499. https://doi.org/10.1007/s11199-016-0647-5.
Tang, T., Fang, E., & Feng, W. (2014). Is neutral really neutral? The effects of neutral usergenerated content on product sales. Journal of Marketing, 78(4), 41–58.
Thomas, K. A., & Clifford, S. (2017). Validity and Mechanical Turk: An assessment of
exclusion methods and interactive experiments. Computers in Human Behavior, 77,
184–197. https://doi.org/10.1016/j.chb.2017.08.038.
Thon, F. M., & Jucks, R. (2017). Believing in expertise: How authors’ credentials and
language use influence the credibility of online health information. Health
Communication, 32(7), 828–836. https://doi.org/10.1080/10410236.2016.1172296.
Timmers, M., Fischer, A. H., & Manstead, A. S. R. (2003). Ability versus vulnerability:
Beliefs about men’s and women’s emotional behaviour. Cognition & Emotion, 17(1),
41–63. https://doi.org/10.1080/02699930302277.
Ullah, R., Amblee, N., Kim, W., & Lee, H. (2016). From valence to emotions: Exploring the
distribution of emotions in online product reviews. Decision Support Systems, 81,
41–53. https://doi.org/10.1016/j.dss.2015.10.007.
Van Noort, G., & Willemsen, L. M. (2012). Online damage control: The effects of proactive
versus reactive webcare interventions in consumer-generated and brand-generated
platforms. Journal of Interactive Marketing (Elsevier), 26(3), 131–140. https://doi.org/
10.1016/j.intmar.2011.07.001.
Verhagen, T., Nauta, A., & Feldberg, F. (2013). Negative online word-of-mouth:
Behavioral indicator or emotional release? Computers in Human Behavior, 29(4),
1430–1440. https://doi.org/10.1016/j.chb.2013.01.043.
Vermeulen, A., Vandebosch, H., & Heirman, W. (2018). #Smiling, #venting, or both?
Adolescents’ social sharing of emotions on social media. Computers in Human
Behavior, 84, 211–219. https://doi.org/10.1016/j.chb.2018.02.022.
Vonk, R., & Ashmore, R. D. (2003). Thinking about gender types: Cognitive organization
of female and male types. British Journal of Social Psychology, 42(2), 257.
Wang, S. S., Moon, S.-I., Kwon, K. H., Evans, C. A., & Stefanone, M. A. (2010). Face off:
Implications of visual cues on initiating friendship on Facebook. Computers in Human
Behavior, 26(2), 226–234. https://doi.org/10.1016/j.chb.2009.10.001.
Wigley, S., & Lewis, B. K. (2012). Rules of engagement: Practice what you tweet. Public
Relations Review, 38(1), 165–167. https://doi.org/10.1016/j.pubrev.2011.08.020.
Willemsen, L. M., Neijens, P. C., & Bronner, F. (2012). The ironic effect of source identification on the perceived credibility of online product reviewers. Journal of
Computer-Mediated Communication, 18(1), 16–31. https://doi.org/10.1111/j.1083-
6101.2012.01598.x.
Wolf, A. (2000). Emotional expression online: Gender differences in emoticon use.
CyberPsychology and Behavior, 3(5), 827–833. https://doi.org/10.1089/
10949310050191809.
Wood, W., & Eagly, A. H. (2010). Gender. In (5 ed.). S. T. Fiske, D. T. Gilbert, & G. Lindzey
(Vol. Eds.), Handbook of social psychology: Vol. 1, (pp. 629–667). New York, NY: John
Wiley.
Wu, K., Noorian, Z., Vassileva, J., & Adaji, I. (2015). How buyers perceive the credibility
of advisors in online marketplace: Review balance, review count and misattribution.
Journal of Trust Management, 2(1), 1–18. https://doi.org/10.1186/s40493-015-
0013-5.
Xu, Q. (2014). Should I trust him? The effects of reviewer profile characteristics on eWOM
credibility. Computers in Human Behavior, 33, 136–144. https://doi.org/10.1016/j.
chb.2014.01.027.
Yang, J., & Mai, E. (2010). Experiential goods with network externalities effects: An
empirical study of online rating system. Journal of Business Research, 63(9),
1050–1057. https://doi.org/10.1016/j.jbusres.2009.04.029.
Yin, D., Bond, S. D., & Zhang, H. (2014a). Anxious or angry? Effects of discrete emotions
on the perceived helpfulness of online reviews. MIS Quarterly, 38(2), 539–560.
Yin, G., Wei, L., Xu, W., & Chen, M. (2014b). Exploring heuristic cues for consumer
perceptions of online reviews helpfulness: The case of yelp.com. Paper presented at the
pacific asia conference on information systems.
Zhang, J. Q., Craciun, G., & Shin, D. (2010). When does electronic word-of-mouth matter?
A study of consumer product reviews. Journal of Business Research, 63(12),
1336–1341. https://doi.org/10.1016/j.jbusres.2009.12.011.
Zhou, L. Y., Dawson, M. L., Herr, C. L., & Stukas, S. K. (2004). American and Chinese
college students’ predictions of people’s occupations, housework responsibilities, and
hobbies as a function of cultural and gender influences. Sex Roles, 50(7–8), 547–563.
Zhou, S., & Guo, B. (2015). The interactive effect of review rating and text sentiment on review
helpfulness, Vol. 239. Springer Verlag.
Zhu, L., Yin, G., & He, W. (2014). Is this opinion leader’s review useful? Peripheral cues
for online review helpfulness. Journal of Electronic Commerce Research, 15(4),
267–280.

Design for the pricing strategy of return-freight insurance based on online product reviews

Geng S, Li W, Qu X, Chen L, (2017), Design for the pricing strategy of return-freight insurance based on online product reviews, Electronic Commerce Research and ApplicationsVolume 25, September–October 2017, Pages 16-28

https://www.sciencedirect.com/science/article/pii/S156742231730039X

Mots clés : Assurance retour de fret, Avis de produit en ligne, Incertitude sur l’ajustement du produit, Politique de retour

Résumé : Pour résoudre les litiges liés aux achats en ligne avec le retour des produits, certaines compagnies d’assurance ont développé un nouveau type d’assurance appelé assurance retour-fret pour compenser la perte de frais de retour par les consommateurs. La détermination traditionnelle des primes d’assurance n’a pas complètement fusionné tous les facteurs de commerce électronique, tels que l’incertitude de l’ajustement des produits des achats en ligne, qui pourrait affecter à la fois la demande d’assurance et la quantité de retour. Sur la base de ces caractéristiques, nous développons un modèle de maximisation des bénéfices en termes de certains paramètres de réaction du marché, en particulier l’incertitude de l’ajustement du produit, et calculons la stratégie de tarification optimale, y compris la prime d’assurance et la compensation. En utilisant la théorie des perspectives, nous expliquons pourquoi les avis de produits en ligne pourrait influencer le comportement d’aversion au risque des demandeurs d’assurance dans la situation du commerce électronique. Ensuite, nous résolvons pour la prime et la compensation raisonnables accordées aux avis de produits en ligne du point de vue de la compagnie d’assurance et obtenons un certain nombre de directives managériales pour utiliser les variables de marketing et de stratégie opérationnelle pour influencer ces paramètres de réaction afin d’obtenir le maximum d’avantages du marché. Il est intéressant de noter que lorsque la sensibilité des consommateurs à l’incertitude sur l’ajustement du produit est modérée, une augmentation de l’incertitude sur l’ajustement du produit déplace la prime d’assurance et la compensation dans la direction opposée.

Grandes lignes :

  • Assurance de retour de fret, qui compense la perte de frais de retour de produit en ligne.
  • L’incertitude liée à l’ajustement du produit doit être prise en compte lors de l’analyse de la stratégie de tarification de l’assurance retour-fret.
  • La relation entre la prime d’assurance retour-fret et l’incertitude sur l’ajustement du produit n’est pas une corrélation positive.
  • Le bénéfice de l’assureur n’augmente pas toujours à mesure que la prime d’assurance retour-fret augmente.
  • L’aléa moral doit être considéré comme une contrainte importante dans la conception d’une stratégie de tarification d’assurance.

Banjo, S., 2013. Rampant returns plague e-retailers. Wall Street J.
Barberis, Nicholas C., 2013. Thirty years of prospect theory in economics: a review
and assessment. J. Econ. Perspect. 27 (1), 173–196.
Barseghyan, Levon, Molinari, Francesca, O’Donoghue, Ted, Teitelbaum, Joshua C.,

  1. The nature of risk preferences: evidence from insurance choices. Am.
    Econ. Rev. 103 (6), 2499–2529.
    Benartzi, Shlomo, Previtero, Alessandro, Thaler, Richard H., 2011. Annuitization
    puzzles. J. Econ. Perspect. 25 (4), 143–164.
    Chen, Yubo, Xie, Jinhong, 2008. Online consumer review: word-of-mouth as a new
    element of marketing communication mix. Manage. Sci. 54 (3), 477–491.
    Cox, Donald F., Rich, Stuart U., 1964. Perceived risk and consumer decision-making:
    the case of telephone shopping. J. Mark. Res. 1 (4), 32–39.
    De Roover, Florence Edler, 1945. Early examples of marine insurance. J. Econ. Hist. 5
    (02), 172–200.
    Dellarocas, Chrysanthos, 2003. The digitization of word of mouth: promise and
    challenges of online feedback mechanisms. Manage. Sci. 49 (10), 1407–1424.
    Dellarocas, Chrysanthos, 2006. Strategic manipulation of internet opinion forums:
    Implications for consumers and firms. Manage. Sci. 52 (10), 1577–1593.
    Dellarocas, Chrysanthos, Wood, Charles A., 2008. The sound of silence in online
    feedback: Estimating trading risks in the presence of reporting bias. Manage.
    Sci. 54 (3), 460–476.
    Dimoka, Angelika, Yili, Hong, Pavlou, Paul A., 2012. ‘On product uncertainty in
    online markets: theory and evidence’, MIS Q. 36.
    S. Geng et al. / Electronic Commerce Research and Applications 25 (2017) 16–28 27
    The Economist, 2013. ‘Return to santa’, The Economist.
    Edwards, Jeffrey R., Parry, Mark E., 1993. On the use of polynomial regression
    equations as an alternative to difference scores in organizational research. Acad.
    Manag. J. 36 (6), 1577–1613.
    Feyen, Erik, Lester, Rodney R., Roberto De Rezende Rocha, 2011. ‘What drives the
    development of the insurance sector? An empirical analysis based on a panel of
    developed and developing countries’, World Bank Policy Research Working
    Paper Series.
    Geng, Shidao, Wenli, Li, Hao, Chen, 2017. Complimentary return-freight insurance
    as quality signals a new return policy in e-commerce. In: ‘Proceedings of the
    50th Hawaii International Conference on System Sciences’.
    Gu, Bin, Ye, Qiang, 2014. First step in social media: measuring the influence of
    online management responses on customer satisfaction. Prod. Oper. Manage. 23
    (4), 570–582.
    Gupta, Sumeet, Kim, Hee-Woong, 2010. Value-driven internet shopping: the mental
    accounting theory perspective. Psychol. Market. 27 (1), 13–35.
    Hong, Yili, Pavlou, Paul A., 2014. Product fit uncertainty in online markets: nature,
    effects, and antecedents. Inf. Syst. Res. 25 (2), 328–344.
    Hu, Nan, Bose, Indranil, Koh, Noi Sian, Liu, Ling, 2012. Manipulation of online
    reviews: an analysis of ratings, readability, and sentiments. Decis. Support Syst.
    52 (3), 674–684.
    Hu, Nan, Zhang, Jie, Pavlou, Paul A., 2009. Overcoming the j-shaped distribution of
    product reviews. Commun. ACM 52 (10), 144–147.
    Hu, Wei-Yin, Scott, Jason S., 2007. Behavioral obstacles in the annuity market. Finan.
    Anal. J. 63 (6), 71–82.
    John, A.H., 1958. The london assurance company and the marine insurance market
    of the eighteenth century. Economica 25 (98), 126–141.
    Kahneman, Daniel, Tversky, Amos, 1979. Prospect theory: an analysis of decision
    under risk. Econometrica 47 (2), 263–291.
    Keane, Michael, Stavrunova, Olena, 2016. Adverse selection, moral hazard and the
    demand for medigap insurance. J. Econometrics 190 (1), 62–78.
    Kim, Hee-Woong, Yunjie, Xu, Gupta, Sumeet, 2012. Which is more important in
    internet shopping, perceived price or trust? Electron. Commer. Res. Appl. 11 (3),
    241–252.
    Kim, Youngsoo, Krishnan, Ramayya, 2015. On product-level uncertainty and
    online purchase behavior: an empirical analysis. Manage. Sci. 61 (10), 2449–
    2467.
    Kwark, Young, Chen, Jianqing, Raghunathan, Srinivasan, 2014. Online product
    reviews: implications for retailers and competing manufacturers. Inf. Syst. Res.
    25 (1), 93–110.
    Lawton, Christopher, 2008. The war on returns. Wall Street J. 8 (1).
    Li, Xinxin, Hitt, Lorin M., 2008. Self-selection and information role of online product
    reviews. Inf. Syst. Res. 19 (4), 456–474.
    Li, Yongjian, Lei, Xu., Li, Dahui, 2013. Examining relationships between the return
    policy, product quality, and pricing strategy in online direct selling. Int. J. Prod.
    Econ. 144 (2), 451–460.
    Lutz, Nancy A., 1989. Warranties as signals under consumer moral hazard. RAND J.
    Econ. 20 (2), 239–255.
    Mayzlin, Dina, 2006. Promotional chat on the internet. Market. Sci. 25 (2), 155–163.
    Minnema, Alec, Tammo, H.A., Bijmolt, Sonja Gensler, Thorsten Wiesel, 2016. To
    keep or not to keep: Effects of online customer reviews on product returns, J.
    Retailing, p. forthcoming.
    Mukhopadhyay, Samar K., Setoputro, Robert, 2005. Optimal return policy and
    modular design for build-to-order products. J. Oper. Manage. 23 (5), 496–506.
    Padmanabhan, V., Png, I.P.L., 1997. Manufacturer’s returns policies and retail
    competition. Market. Sci. 16 (1), 81–94.
    Roselius, Ted, 1971. Consumer rankings of risk reduction methods. J. Market. 35 (1),
    56–61.
    Sahoo, Nachiketa, Chrysanthos Dellarocas, Shuba Srinivasan, 2016. The impact of
    online product reviews on product returns, MSI working paper series.
    Shulman, Jeffrey D., Coughlan, Anne T., Canan Savaskan, R., 2010. Optimal reverse
    channel structure for consumer product returns. Market. Sci. 29 (6), 1071–1085.
    Sydnor, Justin, 2010. (over) insuring modest risks. Am. Econ. J. 2 (4), 177–199.
    Tsay, Andy A., Agrawal, Narendra, 2000. Channel dynamics under price and service
    competition. Manuf. Service Oper. Manage. 2 (4), 372–391.
    Tversky, Amos, Kahneman, Daniel, 1992. Advances in prospect theory: cumulative
    representation of uncertainty. J. Risk Uncertainty 5 (4), 297–323.
    Yang, Shuang, 2012. Customers’cognition value and analysis of return freight
    insurance. J. Insurance Professional College 26 (3), 21–23.
    Zhang, Dayong, Cai, Jing, Dickinson, David G., Kutan, Ali M., 2016. Non-performing
    loans, moral hazard and regulation of the chinese commercial banking system.
    J. Banking Finance 63, 48–60.
    Zhang, Meimei, Hu, Hongwei, 2013. Research on price model of back freight risk
    based on the svm. Soft Sci. 27 (7), 128–132.

A picture is worth a thousand words: Translating product reviews into a product positioning map

Moon S, Kamakura W, (2017), A picture is worth a thousand words: Translating product reviews into a product positioning map, International Journal of Research in Marketing, Volume 34, Issue 1, March 2017, Pages 265-285

https://www.sciencedirect.com/science/article/abs/pii/S016781161630074X

Mots clés : Avis de produits en ligne, Carte de positionnement du produit, Exploration de texte, Psychométrie, Découvrir les produits, Segmentation des consommateurs

Résumé : Les avis sur les produits deviennent omniprésents sur le Web, ce qui représente une riche source d’informations pour les consommateurs sur un large éventail de catégories de produits. Surtout, un avis de produit reflète non seulement la perception et la préférence pour un produit, mais aussi l’acuité, le parti pris et le style d’écriture de la critique. Cet aspect a été négligé dans des études antérieures qui ont tiré des conclusions sur les marques à partir des critiques de produits en ligne. Notre cadre combine des techniques d’exploration de texte basées sur l’apprentissage d’ontologie et des techniques psychométriques pour traduire les critiques de produits en ligne en une carte de positionnement de produit, tout en tenant compte des réponses idiosyncrasiques et des styles d’écriture des critiques individuels ou d’un nombre gérable de groupes de critiques (c.-à-d., Les méta-critiques). Nos illustrations empiriques utilisant des critiques de vins et d’hôtels montrent qu’une revue de produit révèle des informations sur le critique (pour l’exemple de vin avec un petit nombre de critiques d’experts) ou le méta-critique (pour l’exemple d’hôtel avec un nombre énorme de critiques réduit à un nombre gérable de méta-évaluateurs), ainsi que sur le produit examiné.

Grandes lignes :

  • Les avis sur les produits deviennent omniprésents sur le Web.
  • Un avis de produit reflète non seulement la perception et la préférence pour un produit, mais aussi l’acuité, le parti pris et le style d’écriture de la critique.

Aggarwal, P., Vaidyanathan, R., & Venkatesh, A. (2009). Using lexical semantic analysis to derive online brand positions: An application to retail marketing research.
Journal of Retailing, 85(2), 145–158.
Alba, J. W., & Hutchinson, J. W. (1987). Dimensions of consumer expertise. Journal of Consumer Research, 13(4), 411–454.
Anderson, C. K. (2012). The impact of social media on lodging performance. Cornell Hospitality Report, 12(15), 6–11.
Archak, N., Ghose, A., & Ipeirotis, P. G. (2011). Deriving the pricing power of product features by mining consumer reviews. Management Science, 57(8), 1485–1509.
Buitelaar, P., Cimiano, P., & Magnini, B. (2005). Ontology learning from text: Methods, evaluation and applications. IOS Press.
Camacho, N., De Jong, M., & Stremersch, S. (2014). The effect of customer empowerment on adherence to expert advice. International Journal of Research in Marketing,
31(3), 293–308.
Carroll, J. D., & Green, P. E. (1997). Psychometric methods in marketing research: Part II. Multidimensional scaling. Journal of Marketing Research, 34(May), 193–204.
Chevalier, J. A., & Mayzlin, D. (2006). The effect of word of mouth on sales: Online book reviews. Journal of Marketing Research, 43(August), 345–354.
Cimiano, P. (2006). Ontology learning and population from text: Algorithms, valuation and applications. Germany: Springer.
Decker, R., & Trusov, M. (2010). Estimating aggregate consumer preferences from online product reviews. International Journal of Research in Marketing, 27(4),
293–307.
DeSarbo, W. S., Park, J., & Rao, V. R. (2011). Deriving joint space positioning maps from consumer preference ratings. Marketing Letters, 22(1), 1–14.
Faure, C., & Natter, M. (2010). New metrics for evaluating preference maps. International Journal of Research in Marketing, 27(3), 261–270.
Feldman, R., & Sanger, J. (2007). The text mining handbook: Advanced approaches in analyzing unstructured data. Cambridge University Press.
Ghose, A., Ipeirotis, P. G., & Li, B. (2012). Designing ranking systems for hotels on travel search engines by mining user-generated and crowdsourced content. Marketing
Science, 31(3), 493–520.
Holbrook, M. B., Lacher, K. T., & LaTour, M. S. (2006). Audience judgments as the potential missing link between expert judgments and audience appeal: An illustration
based on musical recordings of “My Funny Valentine,”. Journal of the Academy of Marketing Science, 34(1), 8–18.
Kamakura, W. A., & Wedel, M. (2000). Factor analysis and missing data. Journal of Marketing Research, 37(4), 490–498.
Kamakura, W. A., Basuroy, S., & Boatwright, P. (2006). Is silence golden? An inquiry into the meaning of silence in professional product evaluations. Quantitative
Marketing and Economics, 4(2), 119–141.
Kostyra, D. S., Reiner, J., Natter, M., & Klapper, D. (2016). Decomposing the effects of online customer reviews on brand, price, and product attributes. International
Journal of Research in Marketing, 33(1), 11–26.
Lau, K. -N., Lee, K. -H., Lam, P. -Y., & Ho, Y. (2001). Web-site marketing: For the travel-and-tourism industry. The Cornell Hotel and Restaurant Administration Quarterly,
42(6), 55–62.
Lawrence, R. D., Almasi, G. S., & Rushmeier, H. E. (1999). A scalable parallel algorithm for self-organizing maps with applications to sparse data mining problems. Data
Mining and Knowledge Discovery, 3(2), 171–195.
Lee, T. Y., & Bradlow, E. T. (2011). Automated marketing research using online customer reviews. Journal of Marketing Research, 48(5), 881–894.
Liebermann, Y., & Flint-Goor, A. (1996). Message strategy by product-class type: A matching model. International Journal of Research in Marketing, 13(3), 237–249.
Lilien, G., & Rangaswamy, A. (2006). Marketing engineering (Revised 2nd ed.). Bloomington, IN: Trafford Publishing.
Liu, Y. (2006). Word-of-mouth for movies: Its dynamics and impact on box office revenue. Journal of Marketing, 70(3), 74–89.
Maedche, A. (2002). Ontology learning for the semantic web. The Kluwer international series in engineering and computer science. New York: Springer Science+
Business Media.
Moon, S., Park, Y., & Kim, Y. S. (2014). The impact of text product reviews on sales. European Journal of Marketing, 48(11/12), 2176–2197.
Netzer, O., Feldman, R., Goldenberg, J., & Fresko, M. (2012). Mine your own business: Market structure surveillance through text mining. Marketing Science, 31(3),
521–543.
Pang, B., & Lee, L. (2008). Opinion mining and sentiment analysis. Foundations and Trends in Information Retrieval, 2(1–2), 1–135.
Pazienza, M., Pennacchiotti, M., & Zanzotto, F. M. (2005). Terminology extraction: An analysis of linguistic and statistical approaches. Knolwedge mining. Of the series
studies in fuzziness and soft computing, Vol. 185. (pp. 255–279).
Peck, J., & Childers, T. L. (2003). Individual differences in haptic information processing: The “need for touch” scale. Journal of Consumer Research, 30(3), 430–442.
Schwarz, G. E. (1978). Estimating the dimension of a model. Annals of Statistics, 6(2), 461–464.
Staab, S., & Studer, R. (2004). Handbook on ontologies. International handbooks on information systems. Springer.
Stone, H., & Sidel, J. L. (2004). Sensory evaluation practices (3rd ed.). Food science and technology, international series. California: Elsevier Academic Press.
Tirunillai, S., & Tellis, G. J. (2014). Mining marketing meaning from online chatter: Strategic brand analysis of big data using latent Dirichlet allocation. Journal of
Marketing Research, 51(August), 463–479.
Wedel, M., & Kamakura, W. A. (2001). Factor analysis with mixed observed and latent variables in the exponential family. Psychometrika, 66(4), 515–530.

A machine learning approach to product review disambiguation based on function, form and behavior classification

Singh A, Tucker C (2017) A machine learning approach to product review disambiguation based on function, form and behavior classification, Decision Support Systems, Volume 97, May 2017, Pages 81-91

https://www.sciencedirect.com/science/article/pii/S0167923617300477

Mots clés : Apprentissage automatique, Extraction d’attribut de produit, Exploration de texte, Avis sur les produits, La conception des produits

Résumé : Les évaluations de produits en ligne se sont révélées être une source d’informations viable pour aider les clients à prendre des décisions d’achat éclairées. Dans de nombreux cas, les utilisateurs de plateformes d’achat en ligne ont la possibilité d’évaluer les produits sur une échelle numérique et de fournir également des commentaires textuels concernant un produit acheté. Au-delà de l’utilisation de plateformes de revue de produits en ligne comme systèmes d’aide à la décision client, cette source de données riche en informations pourrait également aider les concepteurs qui cherchent à augmenter les chances de succès de leurs produits sur le marché grâce à une meilleure compréhension des besoins du marché. Cependant, la taille et la complexité croissantes des produits sur le marché rendent difficile l’analyse manuelle de ces données. Les informations obtenues à partir de ces sources, si elles ne sont pas exploitées correctement, risquent de déformer le véritable succès / échec d’un. L’objectif de cet article est triple: i) proposer une approche d’apprentissage automatique qui dissipe les commentaires des clients en ligne en les classant en l’une des trois caractéristiques directes du produit (c.-à-d. La forme ,fonction ou comportement ) et deux caractéristiques indirectes du produit (c.-à-d. service et autre ), ii) pour découvrir l’ algorithme d’apprentissage automatique qui donne les résultats les plus élevés et les plus généralisables pour atteindre l’objectif i) et iii) pour quantifier la corrélation entre les évaluations de produits et les évaluations directes et les caractéristiques indirectes du produit. Une étude de cas impliquant des données d’examen pour des produits extraits de sites Web de commerce électronique est présentée pour démontrer la validité de la méthode proposée. Une approche de validation multicouche est présentée pour explorer la généralisation de la méthode proposée. Les contributions scientifiques de ce travail ont le potentiel de transformer la manière dont les concepteurs de produits et les clients intègrent les avis sur les produits dans leurs processus décisionnels en quantifiant la relation entre les avis sur les produits et les caractéristiques des produits.

Grandes lignes :

  • Les évaluations de produits en ligne sont une source d’informations viable pour aider les clients à prendre des décisions d’achat.
  • Elles peuvent aider les concepteurs qui cherchent à augmenter les chances de succès de leurs produits.
  • Classification par apprentissage automatique de la forme, de la fonction et du comportement du produit
  • Précisions de classification d’apprentissage automatique de plus de 82% pour le modèle de base
  • Corrélation entre les évaluations de produits et la forme, la fonction et le comportement des produits
  • La corrélation entre la forme des produits et les notes des produits a donné une valeur de 0,934

[1] N.M.A. Al-Othman, The relationship between online reading rates and performance
on proficiency tests, The Reading Matrix 3 (2003).
[2] N. Archak, A. Ghose, P.G. Ipeirotis, Deriving the pricing power of product features by
mining consumer reviews, Management Science 57 (2011) 1485–1509.
[3] K.J. Arrow, Social Choice and Individual Values, Yale University Press, 2012.
[4] S. Asur, B.A. Huberman, Predicting the future with social media, Web Intelligence
and Intelligent Agent Technology (WI-IAT)2010 IEEE/WIC/ACM International Conference on. IEEE 2010, pp. 492–499.
[5] X. Bai, Predicting consumer sentiments from online text, Decision Support Systems
50 (2011) 732–742.
[6] D.M. Blei, A.Y. Ng, M.I. Jordan, Latent dirichlet allocation, J. Mach. Learn. Res. 3
(2003) 993–1022.
[7] A. Brew, D. Greene, P. Cunningham, Using Crowdsourcing and Active Learning to
Track Sentiment in Online Media, in: Proceedings of the 2010 Conference on ECAI
2010: 19th European Conference on Artificial Intelligence, IOS Press, Amsterdam,
The Netherlands, The Netherlands, 2010 145–150.
[8] K. Dave, S. Lawrence, D.M. Pennock, Mining the peanut gallery: opinion extraction
and semantic classification of product reviews, Proceedings of the 12th International Conference on World Wide Web, ACM 2003, pp. 519–528.
[9] T. Fawcett, ROC graphs: notes and practical considerations for researchers, Mach.
Learn. 31 (2004) 1–38.
[10] O. Feiguina, G. Lapalme, Query-based summarization of customer reviews, Advances
in Artificial Intelligence, Springer 2007, pp. 452–463.
[11] C. Forman, A. Ghose, B. Wiesenfeld, Examining the relationship between reviews
and sales: the role of reviewer identity disclosure in electronic markets, Inf. Syst.
Res. 19 (2008) 291–313.
[12] M. Galkin, D. Mouromtsev, S. Auer, Identifying web tables: supporting a neglected
type of content on the web, International Conference on Knowledge Engineering
and the Semantic Web, Springer 2015, pp. 48–62.
[13] R. Ghani, K. Probst, Y. Liu, M. Krema, A. Fano, Text mining for product attribute extraction, ACM SIGKDD Explorations Newsletter 8 (2006) 41–48.
[14] A. Ghose, P.G. Ipeirotis, Designing novel review ranking systems: predicting the usefulness and impact of reviews, Proceedings of the Ninth International Conference on
Electronic Commerce, ACM 2007, pp. 303–310.
[15] M. Hall, E. Frank, G. Holmes, B. Pfahringer, P. Reutemann, I.H. Witten, The WEKA
data mining software: an update, ACM SIGKDD Explorations Newsletter 11 (2009)
10–18.
[16] G.A. Hazelrigg, The implications of Arrow’s impossibility theorem on approaches to
optimal engineering design, J. Mech. Des. 118 (1996) 161–164.
[17] B. He, C. Macdonald, J. He, I. Ounis, An effective statistical approach to blog post
opinion retrieval, Proceedings of the 17th ACM Conference on Information and
Knowledge Management, ACM 2008, pp. 1063–1072.
[18] S.S. Htay, K.T. Lynn, Extracting product features and opinion words using pattern
knowledge in customer reviews, Sci. World J. 2013 (2013).
[19] M. Hu, B. Liu, Mining opinion features in customer reviews, AAAI 2004, pp. 755–760.
[20] N. Hu, I. Bose, N.S. Koh, L. Liu, Manipulation of online reviews: an analysis of ratings,
readability, and sentiments, Decis. Support. Syst. 52 (2012) 674–684, http://dx.doi.
org/10.1016/j.dss.2011.11.002.
[21] Import.io|Web Data Platform & Free Web Scraping Tool [WWW Document], n.d.
Import.io. URL https://www.import.io/ (accessed 10.10.16).
[22] Y. Jiang, J. Shang, Y. Liu, Maximizing customer satisfaction through an online recommendation system: a novel associative classification model, Decis. Support Systems
48 (2010) 470–479.
[23] S.W. Kang, C. Tucker, An automated approach to quantifying functional interactions
by mining large-scale product specification data, J. Eng. Des. 0 (2015) 1–24, http://
dx.doi.org/10.1080/09544828.2015.1083539.
[24] S.-M. Kim, P. Pantel, T. Chklovski, M. Pennacchiotti, Automatically assessing review
helpfulness, Proceedings of the 2006 Conference on Empirical Methods in Natural
Language Processing, Association for Computational Linguistics 2006, pp. 423–430.
[25] S. Kotsiantis, Supervised Machine Learning: A Review of Classification Techniques,
2007.
[26] J.R. Landis, G.G. Koch, The measurement of observer agreement for categorical data,
Biometrics (1977) 159–174.
[27] R.Y. Lau, C. Li, S.S. Liao, Social analytics: learning fuzzy product ontologies for aspectoriented sentiment analysis, Decis. Support. Syst. 65 (2014) 80–94.
[28] A.J. Lee, F.-C. Yang, C.-H. Chen, C.-S. Wang, C.-Y. Sun, Mining perceptual maps from
consumer reviews, Decis. Support Syst. 82 (2016) 12–25.
[29] A.J.T. Lee, F.-C. Yang, C.-H. Chen, C.-S. Wang, C.-Y. Sun, Mining perceptual maps from
consumer reviews, Decis. Support. Syst. 82 (2016) 12–25, http://dx.doi.org/10.1016/
j.dss.2015.11.002.
[30] N. Lei, S.K. Moon, A decision support system for market-driven product positioning
and design, Decis. Support. Syst. 69 (2015) 82–91, http://dx.doi.org/10.1016/j.dss.
2014.11.010.
[31] B. Liu, M. Hu, J. Cheng, Opinion Observer: Analyzing and Comparing Opinions on the
Web, Proceedings of the 14th International Conference on World Wide WebACM
2005, pp. 342–351.
[32] H.-M. Lu, Detecting short-term cyclical topic dynamics in the user-generated content and news, Decis. Support. Syst. 70 (2015) 1–14.
[33] S.M. Mudambi, D. Schuff, What Makes a Helpful Review? A Study of Customer Reviews on Amazon.com (SSRN Scholarly Paper No. ID 2175066), Social Science Research Network, Rochester, NY, 2010.
[34] D.L. Olson, D. Delen, Y. Meng, Comparative analysis of data mining methods for
bankruptcy prediction, Decis. Support. Syst. 52 (2012) 464–473.
[35] M.F. Porter, An algorithm for suffix stripping, Program 14 (1980) 130–137.
[36] A. Reyes, P. Rosso, Making objective decisions from subjective data: detecting irony
in customer reviews, Decis. Support. Syst. 53 (2012) 754–760.
[37] S. Rose, N. Hair, M. Clark, Online customer experience: a review of the business-toconsumer online purchase context, Int. J. Manag. Rev. 13 (2011) 24–39.
[38] M.A. Rosenman, J.S. Gero, Purpose and function in design: from the socio-cultural to
the techno-physical, Des. Stud. 19 (1998) 161–186.
[39] N. Salkind, Encyclopedia of Measurement and Statistics, SAGE Publications, Inc.,
2455 Teller Road, Thousand Oaks California 91320 United States, 2007.
[40] A.S. Singh, C.S. Tucker, Investigating the heterogeneity of product feature preferences mined using online product data streams, ASME 2015 International Design
Engineering Technical Conferences and Computers and Information in Engineering
Conference, American Society of Mechanical Engineers, 2015 (p. V02BT03A020-
V02BT03A020).
[41] S. Tuarob, C.S. Tucker, Quantifying product favorability and extracting notable product features using large scale social media data, J. Comput. Inf. Sci. Eng. 15 (2015)
031003.
[42] S. Tuarob, C.S. Tucker, Automated discovery of lead users and latent product features
by mining large scale social media networks, J. Mech. Des. 137 (2015) 071402.
[43] C. Tucker, H. Kim, Predicting emerging product design trend by mining publicly
available customer review data, DS 68-6: Proceedings of the 18th International Conference on Engineering Design (ICED 11), Impacting Society Through Engineering
Design, Vol. 6: Design Information and Knowledge, Lyngby/Copenhagen, Denmark,
15.-19.08. 2011, 2011.
[44] L. Wang, B.D. Youn, S. Azarm, P.K. Kannan, Customer-driven product design selection using web based user-generated content, in: ASME 2011 International Design
Engineering Technical Conferences and Computers and Information in Engineering
Conference, American Society of Mechanical Engineers, 2011 405–419.
[45] Y. Yu, W. Duan, Q. Cao, The impact of social and conventional media on firm equity
value: a sentiment analysis approach, Decis. Support. Syst. 55 (2013) 919–926.
[46] L. Zhuang, F. Jing, X.-Y. Zhu, Movie review mining and summarization, Proceedings
of the 15th ACM International Conference on Information and Knowledge Management, ACM 2006, pp. 43–50.

The effect of manipulating online product reviews, Journal of Business Research

Zhuang W, Cui G, Peng L, (2018), Manufactured opinions: The effect of manipulating online product reviews, Journal of Business Research, Volume 87, June 2018, Pages 24-35

https://www.sciencedirect.com/science/article/abs/pii/S0148296318300912

Mots clés : Avis de produits en ligne, Manipulation, Soupçon, Persuasion, Commerce électronique

Résumé : Des recherches antérieures supposent que les consommateurs peuvent détecter et ignorer la manipulation des avis sur les produits en ligne ou sont inconscients de telles pratiques. Nous supposons que l’équilibre se produit en raison des signaux de manipulation, de la suspicion des consommateurs et de leur expertise. Notre analyse des données sur l’occupation des hôtels montre que l’effet de l’ajout d’avis positifs et de la suppression d’avis négatifs sur les ventes présente une courbe en U inversée. De plus, les marques faibles souffrent davantage d’un ajout excessif. Nos expériences en laboratoire montrent que l’ajout affecte l’intention d’achat du consommateur, mais il suscite également des soupçons, ce qui exerce un effet médiateur négatif. La suppression est plus déguisée et difficile à soupçonner. Les novices sont plus influencés par les manipulations que leurs homologues expérimentés. Un ajout excessif entraîne la méfiance des consommateurs et peut se retourner contre eux. La suppression exacerbe l’asymétrie d’information et entraîne une sélection défavorable, ce qui justifie la retenue et la réglementation.

Grandes lignes :

  • Un ajout excessif entraîne la méfiance des consommateurs et peut se retourner contre eux. 
  • La suppression est plus déguisée et difficile à soupçonner. 
  • La suppression exacerbe l’asymétrie d’information et entraîne une sélection défavorable, ce qui justifie la retenue et la réglementation.

Ahluwalia, R., & Burnkrant, R. E. (2004). Answering questions about questions: A persuasion knowledge perspective for understanding the effects of rhetorical questions.
Journal of Consumer Research, 31(1), 26–42.
Akerlof, G. A., & Shiller, R. J. (2015). Phishing for phools: The economics of manipulation
and deception. Princeton University Press.
Anderson, E. T., & Simester, D. I. (2014). Reviews without a purchase: Low ratings, loyal
customers, and deception. Journal of Marketing Research, 51(3), 249–269.
Anderson, M., & Magruder, J. (2012). Learning from the crowd: Regression discontinuity
estimates of the effects of an online review database. The Economic Journal, 122(563),
957–989.
Campbell, M. C., & Kirmani, A. (2000). Consumers’ use of persuasion knowledge: The
effects of accessibility and cognitive capacity on perception of an influence agent.
Journal of Consumer Research, 27(1), 69–83.
Chen, Y., Wang, Q., & Xie, J. (2011). Online social interactions: A natural experiment on
word of mouth versus observational learning. Journal of Marketing Research, 48(2),
238–254.
Cui, G., Lui, H. K., & Guo, X. (2012). The effect of online consumer reviews on new
product sales. International Journal of Electronic Commerce, 17(1), 39–57.
Darke, P. R., & Ritchie, R. J. B. (2007). The defensive consumer: Advertising deception,
defensive processing, and distrust. Journal of Marketing Research, 44(1), 114–127.
Dellarocas, C. (2006). Strategic manipulation of internet opinion forums: Implications for
consumers and firms. Management Science, 52(10), 1577–1593.
Dellarocas, C., Zhang, M. X., & Awad, N. F. (2007). Exploring the value of online product
reviews in forecasting sales: The case of motion pictures. Journal of Interactive
Marketing, 21(4), 23–45.
Einwiller, S. A., Fedorikhin, A., Johnson, A. R., & Kamins, M. A. (2006). Enough is enough! When identification no longer prevents negatve corporate associations. Journal
of the Academy of Marketing Science, 34(2), 185–194.
Filieri, R. (2015). What makes online reviews helpful? A diagnosticity-adoption framework to explain informational and normative influences in e-WOM. Journal of
Business Research, 68(6), 1261–1270.
Finkle, J.. The emerging ‘Fake Fan’ economy. (2013). Retrieved from http://www.
businessspectator.com.au/article/2013/8/19/technology/emerging-fake-faneconomy (accessed 18 May 2014).
Friestad, M., & Wright, P. (1994). The persuasion knowledge model: How people cope
with persuasion attempts. Journal of Consumer Research, 21(1), 1–31.
Fulmer, I. S., Barry, B., & Long, D. A. (2009). Lying and smiling: Informational and
emotional deception in negotiation. Journal of Business Ethics, 88(4), 691–709.
Gössling, S. C., Hall, M., & Andersson, A.-C. (2018). The manager’s dilemma: A conceptualization of online review manipulation strategies. Current Issues in Tourism,
21(5), 484–503.
Hayes, A. F., Preacher, K. J., & Myers, T. A. (2011). Mediation and the estimation of
M. Zhuang et al. Journal of Business Research 87 (2018) 24–35
34
indirect effects in political communication research. In E. P. Bucy, & R. L. Holbert
(Eds.). Sourcebook for political communication research: Methods, measures, and analytical techniques (pp. 434–465). New York: Routledge.
Ho-Dac, N. N., Carson, S. J., & Moore, W. L. (2013). The effects of positive and negative
online customer reviews: Do brand strength and category maturity matter? Journal of
Marketing, 77(6), 37–53.
Hu, N., Bose, I., Gao, Y., & Liu, L. (2011). Manipulation in digital word-of-mouth: A
reality check for book reviews. Decision Support Systems, 50(3), 627–635.
Hu, N., Bose, I., Koh, N. S., & Liu, L. (2012). Manipulation of online reviews: An analysis
of ratings, readability, and sentiments. Decision Support Systems, 52(3), 674–684.
Hu, N., Liu, L., & Sambamurthy, V. (2011). Fraud detection in online consumer reviews.
Decision Support Systems, 50(3), 614–626.
Jain, S. P., & Posavac, S. S. (2001). Prepurchase attribute verifiability, source credibility,
and persuasion. Journal of Consumer Psychology, 11(3), 169–180.
Jindal, N., & Liu, B. (2008). Opinion spam and analysis. Proceeding of International
Conference on Web Search and Data Mining, WSDM 08 (pp. 219–230). California:
Stanford University.
Kirmani, A. (1990). The effect of perceived advertising costs on brand perceptions.
Journal of Consumer Research, 17(2), 160–171.
Kirmani, A., & Zhu, J. R. (2007). Vigilant against manipulation: The effects of regulatory
focus on the use of persuasion knowledge. Journal of Marketing Research, 44(4),
688–701.
Lappas, T., Sabnis, G., & Valkanas, G. (2016). The impact of fake positive reviews on
online visibility: A vulnerability assessment of the hotel industry. Information Systems
Research, 27(4), 940–961.
Luca, M., & Zervas, G. (2016). Fake it till you make it: Reputation, competition, and Yelp
review fraud. Management Science, 62(12), 3412–3427.
Mayzlin, D. (2006). Promotional chat on the internet. Marketing Science, 25(2), 155–163.
Mayzlin, D., Dover, Y., & Chevalier, J. (2014). Promotional reviews: An empirical investigation of online review manipulation. American Economic Review, 104(8),
2421–2455.
McCornack, S. A., & Levine, T. R. (1990). When lies are uncovered: Emotional and relational outcomes of discovered deception. Communication Monographs, 57(2),
119–138.
Moorthy, S., & Hawkins, S. A. (2005). Advertising repetition and quality perception.
Journal of Business Research, 58(3), 354–360.
Morrison, P.. The Yelp wars: False reviews, slander and anti-SLAPP: What’s ethical in online
reviewing. (2011). Retrieved from http://www.scpr.org/programs/patt-morrison/
2011/08/25/20426/yelpamazonfakereviewcitysearchtripadvisorantislapp (Accessed
25 August 2013).
Northrup, L. (2009). Academic publisher pays professors for shill Amazon reviews.
Retrieved from http://consumerist.com/5313215/academic-publisher-paysprofessors-for-shill-amazon-reviews, Accessed date: 31 July 2009.
Pullig, C., Netemeyer, R. G., & Biswas, A. (2006). Attitude basis, certainty, and challenge
alignment: A case of negative brand publicity. 34(4), 528–542.
Quipp, J.. 50+ sites to help you bury negative posts about you or your company!. (2008).
Retrieved from http://www.searchenginepeople.com/blog/50-sites-to-help-youbury-negative-posts-about-you-oryour-company.htm (Accessed 25 August 2014).
Reimer, T., & Benkenstein, M. (2016). When good WOM hurts and bad WOM gains: The
effect of untrustworthy online reviews. Journal of Business Research, 69(12),
5993–6001.
Sen, S., & Lerman, D. (2007). Why are you telling me this? An examination into negative
consumer reviews on the web. Journal of Interactive Marketing, 21(4), 76–94.
Shu, S. B., & Carlson, K. A. (2014). When three charms but four alarms: Identifying the
optimal number of claims in persuasion settings. Journal of Marketing, 78(1),
127–139.
Smith, D., Menon, S., & Sivakumar, K. (2005). Online peer and editorial recommendations, trust, and choice in virtual markets. Journal of Interactive Marketing, 19(3),
15–37.
Snijders, T., & Bosker, R. J. (2012). Multilevel analysis: An introduction to basic and advanced multilevel modeling. Sage Publications.
Stiglitz, J. E. (2002). Information and the change in the paradigm in economics. The
American Economic Review, 92(3), 460–501.
Teixeira, T., Picard, R., & Kaliouby, R. (2014). Why, when and how much to entertain
consumers in advertisements? A web-based facial tracking field study. Marketing
Science, 33(6), 809–827.
Walther, J., Van Der Heide, B., Hamel, L. M., & Shulman, K. C. (2009). Self-generated
versus other-generated statements and impressions in computer-mediated communication: A test of warranting theory using Facebook. Communication Research, 36(2),
229–253.

Learning to rank products based on online product reviews using a hierarchical deep neural network

Lee H, Hae Rim C, Lee D, (2019), Learning to rank products based on online product reviews using a hierarchical deep neural network, Electronic Commerce Research and Applications, 36.

https://www.sciencedirect.com/science/article/pii/S1567422319300511

Mots clés : Classement des produits, Avis de produits en ligne, Réseau neuronal profond hiérarchique

Résumé : Le classement des produits basé sur les évaluations de produits en ligne consiste à déduire les préférences relatives des utilisateurs entre différents produits en tant que variante de l’analyse des sentiments au niveau de l’entité. Malgré la relation complexe entre la préférence globale de l’utilisateur et les opinions diverses et individuelles, les approches existantes utilisent généralement des hypothèses empiriques sur les caractéristiques de sentiment des produits d’intérêt. Dans cet article, nous proposons une nouvelle approche unifiée pour apprendre à classer les produits en fonction des critiques de produits en ligne. Contrairement aux approches existantes, il utilise des techniques d’apprentissage approfondi pour extraire la représentation de révision latente de haut niveau qui contient les informations les plus sémantiques dans le processus d’apprentissage. Pour cette approche, nous étendons le réseau d’attention hiérarchique récemment proposé pour opérer dans le domaine du classement. Ce réseau apprend de manière hiérarchique les représentations optimales des fonctionnalités des produits et leurs avis grâce à l’utilisation d’encodeurs à deux niveaux basés sur l’attention. Pour construire un modèle de classement plus avancé, plusieurs fonctionnalités ont été ajoutées pour donner suffisamment d’informations sur les préférences relatives des utilisateurs, et deux fonctions représentatives de perte de classement, RankNet et ListNet, ont été appliquées. De plus, nous démontrons que ce réseau surpasse les méthodes existantes de prédiction du classement des ventes sur la base des évaluations de produits en ligne.


Appel, O., Chiclana, F., Carter, J., Fujita, H., 2016. A hybrid approach to the sentiment
analysis problem at the sentence level. Knowl.-Based Syst. 108, 110–124. https://doi.
org/10.1016/j.knosys.2016.05.040.
Bahdanau, D., Cho, K., Bengio, Y., 2015. Neural machine translation by jointly learning to
align and translate. arXiv:1409.0473.
Bashir, S., Afzal, W., Baig, A.R., 2016. Opinion-based entity ranking using learning to
rank. Appl. Soft Comput. 38, 151–163. https://doi.org/10.1016/j.asoc.2015.10.001..
URL: http://www.sciencedirect.com/science/article/pii/S156849461500616X.
Bickart, B., Schindler, R.M., 2001. Internet forums as influential sources of consumer
information. J. Interactive Market. 15, 31–40. https://doi.org/10.1002/dir.1014..
URL: http://www.sciencedirect.com/science/article/pii/S1094996801701843.
Burges, C., Shaked, T., Renshaw, E., Lazier, A., Deeds, M., Hamilton, N., Hullender, G.,

  1. Learning to rank using gradient descent. In: Proceedings of the 22nd international conference on Machine Learning. New York, NY, USA, pp. 89–96. https://doi.
    org/10.1145/1102351.1102363.
    Cao, Z., Qin, T., Liu, T.Y., Tsai, M.F., Li, H., 2007. Learning to rank: From pairwise approach to listwise approach. In: Proceedings of the 24th International Conference on
    Machine Learning. New York, NY, USA, pp. 129–136. https://doi.org/10.1145/
    1273496.1273513.
    Chen, T., Xu, R., He, Y., Wang, X., 2017. Improving sentiment analysis via sentence type
    classification using bilstm-crf and cnn. Expert Syst. Appl. 72, 221–230. https://doi.
    org/10.1016/j.eswa.2016.10.065.. URL: http://www.sciencedirect.com/science/
    article/pii/S0957417416305929.
    Cooijmans, T., Ballas, N., Laurent, C., Alar Gülehre, Courville, A., 2016. Recurrent batch
    normalization. arXiv:1603.09025.
    Decker, R., Trusov, M., 2010. Estimating aggregate consumer preferences from online
    product reviews. Int. J. Res. Mark. 27https://doi.org/10.1016/j.ijresmar.2010.09.
    001.. URL: http://www.sciencedirect.com/science/article/pii/
    S0167811610000753.
    Dellarocas, C., Zhang, X.M., Awad, N.F., 2007. Exploring the value of online product
    reviews in forecasting sales: the case of motion pictures. J. Interactive Market. 21,
    23–45. https://doi.org/10.1002/dir.20087.
    Engonopoulos, N., Lazaridou, A., Paliouras, G., Chandrinos, K., 2011. Els: a word-level
    method for entity-level sentiment analysis. In: Proceedings of the International
    Conference on Web Intelligence, Mining and Semantics. ACM, New York, NY, USA.
    https://doi.org/10.1145/1988688.1988703. pp. 12:1–12:9.
    Fan, Z.P., Che, Y.J., Chen, Z.Y., 2017. Product sales forecasting using online reviews and
    historical sales data: a method combining the bass model and sentiment analysis. J.
    Business Res. 74, 90–100. https://doi.org/10.1016/j.jbusres.2017.01.010.. URL:
    http://www.sciencedirect.com/science/article/pii/S0148296317300231.
    Ganesan, K., Zhai, C., 2012. Opinion-based entity ranking. Inform. Retrieval 15, 116–150.
    https://doi.org/10.1007/s10791-011-9174-8.
    Gerani, S., Mehdad, Y., Carenini, G., Ng, R.T., Nejat, B., 2014. Abstractive summarization
    of product reviews using discourse structure. In: Proceedings of the 2014 Conference
    on Empirical Methods in Natural Language Processing (EMNLP). Association for
    Computational, Linguistics, Doha, Qatar, pp. 1602–1613. URL: http://www.aclweb.
    org/anthology/D14-1168.
    He, R., McAuley, J., 2016. Ups and downs: Modeling the visual evolution of fashion
    trends with one-class collaborative filtering. In: Proceedings of the 25th International
    Conference on World Wide Web, International World Wide Web Conferences Steering
    Committee, Republic and Canton of Geneva Switzerland, pp. 507–517. https://doi.
    org/10.1145/2872427.2883037.
    Hennig-Thurau, T., Gwinner, K.P., Walsh, G., Gremler, D.D., 2004. Electronic word-ofmouth via consumer-opinion platforms: what motivates consumers to articulate
    themselves on the internet? J. Interactive Market. 18, 38–52. https://doi.org/10.
    1002/dir.10073.. URL: http://www.sciencedirect.com/science/article/pii/
    Table 5
    Top 10 highly weighted tokens in the testing set for sampled categories.
    Categories Top 10 tokens
    Action Figures & Statues grandson, tattoo, tock, momma, equipped, pterodactyl, detachable, husky, grace
    Camera & Photo portable, films, recycled, powerfull, film-, 5-pack, zoom, handycam, focus, spruce
    Cell Phones console, pros-, oversized, evolutionary, maturity, realllly, clearance, excellent, snaps, resistant
    Kitchen & Dining chalkboard, gauze, flex, Christian, gripping, shiny, terrier, wide, shipment, mistral
    Skin Care embrace, gland, popularity, inspiration, highlight, boron, frizz, revise, 5 min, spot
    H.-C. Lee, et al. Electronic Commerce Research and Applications 36 (2019) 100874
    9
    S1094996804700961.
    Huang, Z., Xu, W., Yu, K., 2015. Bidirectional lstm-crf models for sequence tagging.
    arXiv:1508.01991.
    Jannach, D., Resnick, P., Tuzhilin, A., Zanker, M., 2016. Recommender systems — beyond
    matrix completion. Commun. ACM 59, 94–102. https://doi.org/10.1145/2891406.
    Jindal, N., Liu, B., 2006. Identifying comparative sentences in text documents. In:
    Proceedings of the 29th Annual International ACM SIGIR Conference on Research
    and Development in Information Retrieval. ACM, New York, NY, USA, pp. 244–251.
    https://doi.org/10.1145/1148170.1148215.
    Kessler, W., Kuhn, J., 2013. Detection of product comparisons – how far does an out-ofthe-box semantic role labeling system take you? In: Proceedings of the 2013
    Conference on Empirical Methods in Natural Language Processing Association for
    Computational Linguistics, Seattle, Washington, USA, pp. 1892–1897. URL: http://
    www.aclweb.org/anthology/D13-1194.
    Kim, Y., 2014. Convolutional neural networks for sentence classification. In: Proceedings
    of the 2014 Conference on Empirical Methods in Natural Language Processing
    (EMNLP). Association for Computational, Linguistics, Doha, Qatar, pp. 1746–1751.
    URL: http://www.aclweb.org/anthology/D14-1181.
    Kingma, D.P., Ba, J., 2014. Adam: a method for stochastic optimization. arXiv:1412.6980.
    Liu, Q., Huang, H., Zhang, C., Chen, Z., Chen, J., 2013. Chinese comparative sentence
    identification based on the combination of rules and statistics. In: International
    Conference on Advanced Data Mining and Applicationspp. 300–310. https://doi.org/
    10.1007/978-3-642-53917-6_27.
    Liu, Y., 2006. Word of mouth for movies: its dynamics and impact on box office revenue.
    J. Marketing 70, 74–89. https://doi.org/10.1509/jmkg.70.3.74.
    Liu, Y., Bi, J.W., Fan, Z.P., 2017. Ranking products through online reviews: a method
    based on sentiment analysis technique and intuitionistic fuzzy set theory. Inform.
    Fusion 36, 149–161. https://doi.org/10.1016/j.inffus.2016.11.012.. URL: http://
    www.sciencedirect.com/science/article/pii/S1566253516301580.
    Liu, Y., Huang, X., An, A., Yu, X., 2007. Arsa: A sentiment-aware model for predicting
    sales performance using blogs. In: Proceedings of the 30th Annual International ACM
    SIGIR Conference on Research and Development in Information Retrieval. ACM, New
    York, NY, USA, pp. 607–614. https://doi.org/10.1145/1277741.1277845.
    Liu, Y., Huang, X., An, A., Yu, X., 2008. Modeling and predicting the helpfulness of online
    reviews. In: 2008 Eighth IEEE International Conference on Data Mining, IEEE, pp.
    443–452. https://doi.org/10.1109/ICDM.2008.94.. URL: https://ieeexplore.ieee.
    org/abstract/document/4781139.
    McAuley, J., Targett, C., Shi, Q., van den Hengel, A., 2015. Image-based recommendations on styles and substitutes. In: Proceedings of the 38th International ACM SIGIR
    Conference on Research and Development in Information Retrieval. ACM, New York,
    NY, USA, pp. 43–52. https://doi.org/10.1145/2766462.2767755.
    Najmi, E., Hashmi, K., Malik, Z., Rezgui, A., Khan, H.U., 2015. Capra: a comprehensive
    approach to product ranking using customer reviews. Computing 97, 843–867.
    https://doi.org/10.1007/s00607-015-0439-8.
    Raffel, C., Ellis, D.P.W., 2015. Feed-forward networks with attention can solve some longterm memory problems. arXiv:1512.08756.
    Romeo, S., Da San Martino, G., Barrón-Cedeno, A., Moschitti, A., Belinkov, Y., Hsu, W.N.,
    Zhang, Y., Mohtarami, M., Glass, J., 2016. Neural attention for learning to rank
    questions in community question answering. In: Proceedings of COLING 2016, the
    26th International Conference on Computational Linguistics: Technical Papers.
    Association for Computational, Linguistics, New York, NY, USA, pp. 1734–1745.
    URL: http://www.aclweb.org/anthology/C/C16/C16-1163.pdf.
    Saumya, S., Singh, J.P., Baabdullah, A.M., Rana, N.P., Dwivedi, Y.K., 2018. Ranking
    online consumer reviews. Electron. Commer. Res. Appl. 29, 78–89. https://doi.org/
    10.1016/j.elerap.2018.03.008.. URL: http://www.sciencedirect.com/science/
    article/pii/S1567422318300358.
    Schneider, M.J., Gupta, S., 2016. Forecasting sales of new and existing products using
    consumer reviews: A random projections approach. Int. J. Forecast. 32, 243–256.
    https://doi.org/10.1016/j.ijforecast.2015.08.005.. URL: http://www.sciencedirect.
    com/science/article/pii/S0169207015001235.
    Song, Y., Wang, H., He, X., 2014. Adapting deep ranknet for personalized search. In:
    Proceedings of the 7th ACM International Conference on Web Search and Data
    Mining. ACM, New York, NY, USA, pp. 83–92. https://doi.org/10.1145/2556195.
    2556234.
    Srivastava, N., Hinton, G., Krizhevsky, A., Sutskever, I., Salakhutdinov, R., 2014. Dropout:
    A simple way to prevent neural networks from overfitting. J. Mach. Learn. Res. 15,
    1929–1958. URL: http://jmlr.org/papers/v15/srivastava14a.html.
    Sun, J., Long, C., Zhu, X., Huang, M., 2009. Mining reviews for product comparison and
    recommendation. In: Polibitspp. 33–40. https://doi.org/10.1145/1148170.1148215.
    Varathan, K.D., Giachanou, A., Crestani, F., 2017. Comparative opinion mining: a review.
    J. Assoc. Inform. Sci. Technol. 68, 811–829. https://doi.org/10.1002/asi.23716.
    Wang, B., Klabjan, D., 2017. An attention-based deep net for learning to rank. arXiv:1702.
    06106.
    Wang, J., Zhao, W.X., He, Y., Li, X., 2015. Leveraging product adopter information from
    online reviews for product recommendation. In: Ninth International AAAI Conference
    on Web and Social Mediapp. 464–472. URL: https://www.aaai.org/ocs/index.php/
    ICWSM/ICWSM15/paper/view/10475.
    Wang, L., Ling, W., 2016. Neural network-based abstract generation for opinions and
    arguments. arXiv:1606.02785.
    Ward, C.B., Choi, Y., Skiena, S., Xavier, E.C., 2011. Empath: A framework for evaluating
    entity-level sentiment analysis. In: 2011 8th International Conference Expo on
    Emerging Technologies for a Smarter Worldpp. 1–6. https://doi.org/10.1109/
    CEWIT.2011.6135866.
    Xu, K., Ba, J., Kiros, R., Cho, K., Courville, A., Salakhudinov, R., Zemel, R., Bengio, Y.,
  2. Show, attend and tell: Neural image caption generation with visual attention.
    In: Bach, F., Blei, D. (Eds.), Proceedings of the 32nd International Conference on
    Machine Learning, PMLR Lille, France, pp. 2048–2057.
    Yagci, I.A., Das, S., 2014. Box office prediction based on microblog. Expert Syst. Appl. 41,
    1680–1689. https://doi.org/10.1016/j.eswa.2013.08.065.
    Yagci, I.A., Das, S., 2018. Measuring design-level information quality in online reviews.
    Electron. Commer. Res. Appl. 30, 102–110. https://doi.org/10.1016/j.elerap.2018.
    05.010.
    Yang, Z., Yang, D., Dyer, C., He, X., Smola, A., Hovy, E., 2016. Hierarchical attention
    networks for document classification. In: Proceedings of the 2016 Conference of the
    North American Chapter of the Association for Computational Linguistics: Human
    Language Technologies Association for Computational Linguistics, San Diego,
    California, pp. 1480–1489. URL: http://www.aclweb.org/anthology/N16-1174.
    Yu, J., Zha, Z.J., Wang, M., Chua, T.S., 2011. Aspect ranking: Identifying important
    product aspects from online consumer reviews. In: Proceedings of the 49th Annual
    Meeting of the Association for Computational Linguistics: Human Language
    Technologies, vol. 1. Association for Computational Linguistics, Stroudsburg, PA,
    USA, pp. 607–614. URL: http://dl.acm.org/citation.cfm?id=2002472.2002654.
    Zhang, K., Cheng, Y., Liao, W.K., Choudhary, A., 2011. Mining millions of reviews: A
    technique to rank products based on importance of reviews. In: Proceedings of the
    13th International Conference on Electronic Commerce. ACM, New York, NY, USA.
    https://doi.org/10.1145/2378104.2378116. pp. 12:1–12:8.
    Zhang, K., Narayanan, R., Choudhary, A., 2010. Voice of the customers: Mining online
    customer reviews for product feature-based ranking. In: Proceedings of the 3rd
    Wonference on Online Social Networks USENIX Association, Berkeley, CA, USA. pp.
    11–11. URL: http://dl.acm.org/citation.cfm?id=1863190.1863201.
    Zhang, Z., Guo, C., Goes, P., 2013. Product comparison networks for competitive analysis
    of online word-of-mouth. ACM Trans. Manage Inf. Syst. 3, 20:1–20:22. https://doi.
    org/10.1145/2407740.2407744.
    Zheng, L., Noroozi, V., Yu, P.S., 2017. Joint deep modeling of users and items using
    reviews for recommendation. In: Proceedings of the Tenth ACM International
    Conference on Web Search and Data Mining. ACM, New York, NY, USA, pp. 425–434.
    https://doi.org/10.1145/3018661.3018665.
    Zhu, F., Zhang, X.M., 2010. Impact of online consumer reviews on sales: The moderating
    role of product and consumer characteristics. J. Marketing 74, 133–148. https://doi.
    org/10.1509/jmkg.74.2.133. DOI: 10.1509/jmkg.74.2.133.

Effect of online product reviews on third parties’ selling on retail platforms

Song W, Li W, Geng S, (2020), Effect of online product reviews on third parties’ selling on retail platforms,  Electronic Commerce Research and Applications, 39.

https://www.sciencedirect.com/science/article/pii/S1567422319300778

Mots clés : Coopétition, Avis de produits en ligne, Effet plateforme, Vendeurs tiers, Plateforme de vente au détail

Résumé : Les détaillants en ligne ouvrent leurs plateformes pour inviter des vendeurs tiers à vendre directement sur leurs plateformes pour des commissions. Étant donné que la plupart des consommateurs prennent des décisions d’achat en utilisant les avis de produits en ligne comme référence, nous développons un modèle de théorie des jeux pour explorer l’impact des avis sur la décision d’un vendeur tiers de vendre sur une plateforme de vente au détail ouverte et sur le profit du détaillant de la plateforme. Sur la base de deux attributs de produit – qualité et ajustement – nous distinguons deux cas, la qualité domine l’ajustement et l’ajustement domine la qualité. Nous constatons que, dans le cadre d’avis symétriques (c.-à-d. D’avis ne favorisant ni le produit du détaillant ni celui d’un tiers), des avis plus élevés homogénéisent les produits, intensifiant ainsi la concurrence entre le détaillant et le tiers dans les domaines où la qualité domine. Cependant, même dans le cadre d’avis asymétriques, le tiers ne peut être incité à vendre sur la plateforme de vente au détail que si l’on considère la qualité des systèmes de révision du détaillant, ce qui peut entraîner un effet de plateforme sur les avis. L’effet de plateforme renforce l’importance des avis, de sorte qu’il puisse élargir la différenciation des produits créée par les avis asymétriques. En particulier, lorsque l’effet de plateforme et l’asymétrie des avis sont suffisamment élevés, le détaillant peut non seulement inciter le tiers à vendre sur sa plateforme, mais également bénéficier à la fois de la qualité domine l’ajustement et de l’ajustement domine la qualité.

Grandes lignes :

  • Dans le cadre d’avis symétriques, des avis plus élevés homogénéisent les produits, intensifiant ainsi la concurrence entre le détaillant et le tiers
  • L’effet de plateforme renforce l’importance des avis

La qualité domine l’ajustement et l’ajustement domine la qualité


Abhishek, V., Jerath, K., Zhang, Z. John, 2016. Agency selling or reselling? Channel
structures in electronic retailing. Manage. Sci. 62 (8), 2259–2280.
Adner, R., Chen, J., Zhu, F., 2019. Frenemies in platform markets: Heterogeneous profit
foci as drivers of compatibility decisions. Manage. Sci Forthcoming.
Anderson, E.W., 1998. Customer satisfaction and word of mouth. J. Service Res. 1 (1),
5–17.
Archak, Nikolay, Ghose, Anindya, Ipeirotis, Panagiotis G., 2011. Deriving the pricing
power of product features by mining consumer reviews. Manage. Sci. 57 (8),
1485–1509.
Chen, J., Guo, Z., 2016. New media advertising and retail platform openness. Working
Paper.
Chen, Y., Xie, J., 2008. Online consumer review: Word-of-mouth as a new element of
marketing communication mix. Manage. Sci. 54 (3), 477–491.
Chevalier, Judith A., Mayzlin, Dina, 2006. The effect of word of mouth on sales: Online
book reviews. J. Mark. Res. 43 (3), 345–354.
Dellarocas, Chrysanthos, 2006. Strategic manipulation of internet opinion forums:
Implications for consumers and firms. Manage. Sci. 52 (10), 1577–1593.
Forman, Chris, Ghose, Anindya, Wiesenfeld, Batia, 2008. Examining the relationship
between reviews and sales: The role of reviewer identity disclosure in electronic
markets. Inform. Syst. Res. 19 (3), 291–313.
Geng, S., Li, W., Qu, X., Chen, L., 2017. Design for the pricing strategy of return-freight
insurance based on online product reviews. Electron. Commer. Res. Appl. 25, 16–28.
Gutt, Dominik, Neumann, Jürgen, Zimmermann, Steffen, Kundisch, Dennis, Chen,
Jianqing, 2019. Design of review systems—A strategic instrument to shape online
reviewing behavior and economic outcomes. J. Strategic Inform. Syst. 28 (2),
104–117.
Hagiu, Andrei, Wright, Julian, 2015. Marketplace or reseller? Manage. Sci. 61 (1),
184–203.
Hao, Lin, Fan, Ming, 2014. An analysis of pricing models in the electronic book market.
MIS Q. 38 (4), 1017–1032.
Hu, Nan, Pavlou, Paul A., Zhang, Jennifer, 2006. Can online reviews reveal a product’s
true quality? empirical findings and analytical modeling of online word-of-mouth
communication. In: Proceedings of the 7th ACM conference on Electronic commerce,
pp. 324–330.
Jerath, Kinshuk, John Zhang, Z., 2010. Store within a store. J. Mark. Res. 47 (4),
748–763.
Kwark, Young, Chen, Jianqing, Raghunathan, Srinivasan, 2014. Online product reviews:
Implications for retailer and competing manufacturers. Inform. Syst. Res. 25 (1),
93–110.
Kwark, Y., Chen, J., Raghunathan, S., 2017. Platform or wholesale? A strategic tool for
online retailers to benefit from third-party information. MIS Q. 41 (3), 763–785.
Kwark, Young, Chen, Jianqing, Raghunathan, Srinivasan, 2018. User-generated content
and competing firms’ product design. Manage. Sci. 64 (10), 4608–4628.
Li, X., Hitt, L.M., 2008. Self-selection and information role of online product reviews.
Inform. Syst. Res. 19 (4), 456–474.
Li, X., Hitt, L.M., Zhang, Z.J., 2011. Product reviews and competition in markets for
repeat purchase products. J. Manage. Inform. Syst. 27 (4), 9–41.
Mantin, Benny, Krishnan, Harish, Dhar, Tirtha, 2014. The strategic role of third-party
marketplaces in retailing. Prod. Operations Manage. 23 (11), 1937–1949.
Mayzlin, Dina, 2006. Promotional chat on the internet. Marketing Sci. 25 (2), 155–163.
Moe, Wendy W., Trusov, Michael, 2011. The value of social dynamics in online product
ratings forums. J. Mark. Res. 48 (3), 444–456.
Ryan, J.K., Sun, D., Zhao, X., 2012. Competition and coordination in online marketplaces.
Prod. Operations Manage. 21 (6), 997–1014.
Sun, Monic, 2012. How does variance of product ratings matter? Manage. Sci. 58 (4),
696–707.
Tan, Y. (Ricky), Carrillo, J.E., 2017. Strategic analysis of the agency model for digital
goods. Prod. Operations Manage. 26 (4), 724–741.
Tian, L., Vakaharia, A.J., Tan, Y. (Ricky), Xu, Y., 2018. Marketplace, reseller, or hybrid:
Strategic analysis of an emerging e-commerce model. Prod. Operations Manage. 27
(8), 1595–1610.
Zhu, Feng, Zhang, Xiaoquan, 2010. Impact of online consumer reviews on sales: the
moderating role of product and consumer characteristics. J. Marketing 74 (2),
133–148.

Experiential product framing and its influence on the creation of consumer reviews

Gallo I, Townsend I, Alegre I, (2019), Experiential product framing and its influence on the creation of consumer reviews, Journal of Business Research, 98, p177-p190.

https://www.sciencedirect.com/science/article/abs/pii/S0148296319300074

Mots clés : Marketing expérimental, Encadrement expérentiel, Critiques de produits, Le bouche à oreille

Résumé : Nous examinons comment le cadrage expérientiel, une tactique de marketing de plus en plus populaire, influence le comportement de révision des consommateurs. Le cadrage expérientiel est une stratégie de communication par laquelle les spécialistes du marketing décrivent un produit matériel comme s’il s’agissait d’une expérience, quelque chose que le consommateur vit, plutôt que de se concentrer sur les fonctionnalités et les attributs du produit. Sur la base de travaux antérieurs comparant la relation des consommateurs avec les produits à celle des expériences ainsi que des travaux antérieurs sur le comportement de révision des produits et le marketing expérientiel, nous émettons l’hypothèse que le cadrage expérientiel augmente la probabilité des consommateurs de revoir un produit. En effet, un examen des données ainsi que deux études en laboratoire montrent que le cadrage d’un produit comme une expérience est associé à une augmentation du bouche à oreille. Nos résultats soutiennent également notre processus proposé ; lorsque les produits sont conçus comme des expériences, les consommateurs les perçoivent comme plus personnels et auto-définis; cela augmente alors la probabilité pour le consommateur de s’engager dans l’activité d’auto-démonstration de l’examen des produits.

Grandes lignes :

  • Le cadrage expérientiel augmente la probabilité des consommateurs de revoir un produit.
  • Le cadrage d’un produit comme une expérience est associé à une augmentation du bouche à oreille
  • Lorsque les produits sont conçus comme des expériences, les consommateurs les perçoivent comme plus personnels

Albert, N., Merunka, D., & Valette-Florence, P. (2013). Brand passion: Antecedents and
consequences. Journal of Business Research, 66(7), 904–909.
Alexandrov, A., Lilly, B., & Babakus, E. (2013). The effects of social- and self-motives on
the intentions to share positive and negative word of mouth. Journal of the Academy of
Marketing Science, 41(5), 531–546.
Anderson, E. W. (1998). Customer satisfaction and word of mouth. Journal of Service
Research, 1(1), 5–17.
Babic Rosario, A., Sotgiu, F., De Valck, K., & Bijmolt, T. H. (2016). The effect of electronic
word of mouth on sales: A meta-analytic review of platform, product, and metric
factors. Journal of Marketing Research, 53(3), 297–318.
Belk, R. W. (1988). Possessions and the extended self. Journal of Consumer Research,
15(3), 139–168.
Berger, J. (2013). Contagious: Why things catch on. New York, NY: Simon and Schuster.
Berger, J. (2014). Word of mouth and interpersonal communication: A review and directions for future research. Journal of Consumer Psychology, 24(4), 586–607.
Berger, J., & Milkman, K. L. (2012). What makes online content viral? Journal of
Marketing Research, 49(2), 192–205.
Brakus, J. J., Schmitt, B. H., & Zarantonello, L. (2009). Brand Experience: What is it? How
is it measured? Does it affect loyalty? Journal of Marketing, 73(3), 52–68.
Bughin, J., Doogan, J., & Vetvik, O. J. (2010). A new way to measure word-of-mouth
marketing. The McKinsey Quarterly, 2, 113–116.
Caprariello, P. A., & Reis, H. T. (2013). To do, to have, or to share? Valuing experiences
over material possessions depends on the involvement of others. Journal of Personality
and Social Psychology, 104(2), 199–215.
Carter, T. J., & Gilovich, T. (2010). The relative relativity of experiential and material
purchases. Journal of Personality and Social Psychology, 98, 146–159.
Carter, T. J., & Gilovich, T. (2012). I am what I do, not what I have: The differential
centrality of experiential and material purchases to the self. Journal of Personality and
Social Psychology, 102(6), 1304–1317.
Chazin, S. M. (2007). Marketing Apple: 5 secrets of the world’s best marketing machine.
Retrieved from http://www.MarketingApple.com.
Chen, Z. (2017). Social acceptance and word of mouth: How the motive to belong leads to
divergent WOM with strangers and friends. Journal of Consumer Research. https://doi.
org/10.1093/jcr/ucx055.
Chen, Z., & Berger, J. (2016). How content acquisition method affects word of mouth.
Journal of Consumer Research, 43(1), 86–102.
Chung, C., & Darke, P. (2006). The consumer as advocate: Self-relevance, culture, and
word of-mouth. Marketing Letters, 17, 269–279.
Csikszentmihalyi, M., & Rochberg-Halton, E. (1981). The meaning of things: Domestic
symbols and the self. Cambridge, UK: Cambridge University Press.
De Matos, C. A., & Rossi, C. A. V. (2008). Word-of-mouth communications in marketing: A
meta-analytic review of the antecedents and moderators. Journal of the Academy of
Marketing Science, 36(4), 578–596.
Dichter, E. (1966). How word of mouth advertising works. Harvard Business Review, 44(6),
147–166.
Dubois, D., Bonezzi, A., & De Angelis, M. (2016). Sharing with friends versus strangers:
How interpersonal closeness influences word-of-mouth valence. Journal of Marketing
Research, 53(5), 712–727.
Dunn, E. W., & Weidman, A. C. (2014). Building a science of spending: Lessons from the
past and directions for the future. Journal of Consumer Psychology, 25(1), 172–178.
Elliot, S. (2013, September 23). Ads for rosewood hotels hope to convey a sense of place.
The New York Times. Retrieved from http://www.nytimes.com/.
Engel, J. F., Blackwell, R. D., & Miniard, P. W. (1993). Consumer behavior (8th ed.). Fort
Worth: Dryden Press.
Escalas, J. E. (2007). Self-referencing and persuasion: Narrative transportation versus
analytical elaboration. Journal of Consumer Research, 33, 421–429.
Gallo, I., Escalas, J., & Sood, S. (2018). Transported through time: The importance of narrative processing, transportation, and consistency on experiential purchases compared to
material purchases (Working Paper)IESE Business School.
Gallo, I., Sood, S., Mann, T. C., & Gilovich, T. (2016). The heart and the head: On choosing
experiences intuitively and possessions deliberatively. Journal of Behavioral Decision
Making, 30, 754–768.
Gentile, C., Spiller, N., & Noci, G. (2007). How to sustain the customer experience: An
overview of experience components that co-create value with the customer. European
Management Journal, 25(5), 395–410.
Gilovich, T., Kumar, A., & Jampol, L. (2015). The beach, the bikini, and the best buy:
Replies to Dunn and Weidman, and to Schmitt, Brakus, and Zarantonello. Journal of
Consumer Psychology, 25(1), 179–184.
Godes, D., & Mayzlin, D. (2009). Firm-created word-of-mouth communication: Evidence
from a field test. Marketing Science, 28, 721–739.
Godes, D., Mayzlin, D., Chen, Y., Das, S., Dellarocas, C., Pfeiffer, B., … Verlegh, P. (2005).
The firm’s management of social interactions. Marketing Letters, 16(3–4), 415–428.
Gummesson, E. (1995). Relationship marketing. Gower handbook of marketing. 4.
Hayes, A. F. (2013). Introduction to mediation, moderation, and conditional process analysis:
A regression-based approach. New York, NY: Guilford Press.
Hennig-Thurau, T., Gwinner, K. P., Walsh, G., & Gremler, D. D. (2004). Electronic wordof-mouth via consumer-opinion platforms: What motivates consumers to articulate
themselves on the internet? Journal of Interactive Marketing, 18, 38–52.
Holbrook, M. B., & Hirschman, E. C. (1982). The experiential aspects of consumption:
Consumer fantasies, feelings, and fun. Journal of Consumer Research, 9(2), 132–140.
Inman, J. J., & Zeelenberg, M. (2002). Regret in repeat purchase versus switching decisions: The attenuating role of decision justifiability. Journal of Consumer Research,
29(1), 116–128.
Jain, S. P., & Posavac, S. S. (2001). Prepurchase attribute verifiability, source credibility,
and persuasion. Journal of Consumer Psychology, 11, 169–180.
I. Gallo et al. Journal of Business Research 98 (2019) 177–190
189
King, R. A., Racherla, P., & Bush, V. D. (2014). What we know and don’t know about
online word-of-mouth: A review and synthesis of the literature. Journal of Interactive
Marketing, 28(3), 167–183.
Kumar, A., & Gilovich, T. (2015). Some “thing” to talk about? Differential story utility
from experiential and material purchases. Personality and Social Psychology Bulletin,
41(10), 1320–1331.
LaSalle, D., & Britton, T. A. (2003). Priceless. Turning ordinary products into extraordinary
experiences. Boston, MA: Harvard Business School Press.
Lovett, M. J., Peres, R., & Shachar, R. (2013). On brands and word of mouth. Journal of
Marketing Research, 50(4), 427–444.
Maxham, J. G., III (2001). Service recovery’s influence on consumer satisfaction, positive
word-of-mouth, and purchase intentions. Journal of Business Research, 54(1), 11–24.
Mazzarol, T., Sweeney, J. C., & Soutar, G. N. (2007). Conceptualizing word-of-mouth
activity, triggers and conditions: An exploratory study. European Journal of Marketing,
41(11/12), 1475–1494.
McAdams, D. P. (2001). The psychology of life stories. Review of General Psychology, 5(2),
100–122.
Mittal, B. (1999). The advertising of services: Meeting the challenge of intangibility.
Journal of Service Research, 2, 98–116.
Muniz, A. M., Jr., & O’Guinn, T. C. (2001). Brand community. Journal of Consumer
Research, 27, 412–432.
Myers, E. (1985). Phenomenological analysis of the importance of special possessions: An
exploratory study. Advances in Consumer Research, 12, 560–565.
Nelson, P. (1970). Information and consumer behavior. Journal of Political Economy, 78,
311–329.
Newman, A. A. (2012, March 7). Marketers promoting a granola bar hit the trails in
national parks. The New York Times. Retrieved from http://www.nytimes.com/.
Nicolao, L., Irwin, J. R., & Goodman, J. K. (2009). Happiness for sale: Do experiential
purchases make consumers happier than material purchases? Journal of Consumer
Research, 36, 188–198.
Nielsen (2015, October 2). Word-of-mouth recommendations remain the most credible.
Retrieved from http://www.nielsen.com.
Nysveen, H., Pedersen, P. E., & Skard, S. (2013). Brand Experiences in service organizations: exploring the individual effects of brand experience dimensions. Journal of
Brand Management, 20(5).
Packard, G., Gershoff, A., & Wooten, D. B. (2016). When boastful word of mouth helps
versus hurts social perceptions and persuasion. Journal of Consumer Research, 43(1),
26–43.
Pan, Y., & Zhang, J. Q. (2011). Born unequal: A study of the helpfulness of user-generated
product reviews. Journal of Retailing, 87(4), 598–612.
Pine, B., & Gilmore, J. H. (1999). The experience economy. Boston, MA: Harvard Business
School Press.
Rimé, B. (2009). Emotion elicits the social sharing of emotion: Theory and empirical
review. Emotion Review, 1, 60–85.
Rust, R. T., & Cooil, B. (1994). Reliability measures for qualitative data: Theory and
implications. Journal of Marketing Research, 1–14.
Schmitt, B., Brakus, J., & Zarantonello, L. (2015). From experiential psychology to consumer experience. Journal of Consumer Psychology, 25(1), 166–171.
Schmitt, B. H. (1999). Experiential marketing: How to get customers to sense, feel, think, act,
and relate to your company and brands. New York: Free Press.
Schmitt, B. H. (2010). Customer experience management: A revolutionary approach to connecting with your customers. New Jersey: John Wiley & Sons.
Sundaram, D. S., Mitra, K., & Webster, C. (1998). Word-of-mouth communications: A
motivational analysis. Advances in Consumer Research, 25, 527–531.
Trusov, M., Bucklin, R. E., & Pauwels, K. (2009). Effects of word-of-mouth versus traditional marketing: Findings from an internet social networking site. Journal of
Marketing, 73(5), 90–102.
Tuškej, U., Golob, U., & Podnar, K. (2013). The role of consumer-brand identification in
building brand relationships. Journal of Business Research, 66(1), 53–59.
Van Boven, L., Campbell, M. C., & Gilovich, T. (2010). Stigmatizing materialism: On
stereotypes and impressions of materialistic and experiential pursuits. Personality and
Social Psychology Bulletin, 36(4), 551–563.
Van Boven, L., & Gilovich, T. (2003). To do or to have? That is the question. Journal of
Personality and Social Psychology, 85(6), 1193–1202.
Wallendorf, M., & Arnould, E. J. (1988). My favorite things: A cross-cultural inquiry into
object attachment, possessiveness, and social linkage. Journal of Consumer Research,
14, 531–547.
Wilson, A. E., & Ross, M. (2003). The identity function of autobiographical memory: Time
is on our side. Memory, 11(2), 137–149.
Wojnicki, A. C., & Godes, D. (2008). Word-of-mouth as self-enhancement (Working paper)
Rotman School of Management, University of Toronto.
Wright, A. A., & Lynch, J. G. (1995). Communication effects of advertising versus direct
experience when both search and experience attributes are present. Journal of
Consumer Research, 21, 708–718.
Yeh, Y., & Choi, S. M. (2011). MINI-lovers, maxi-mouths: An investigation of antecedents
to eWOM intention among brand community members. Journal of Marketing
Communications, 17(3), 145–162.
You, Y., Vadakkepatt, G. G., & Joshi, A. M. (2015). A meta-analysis of electronic word-ofmouth elasticity. Journal of Marketing, 79(2), 19–39.
Zarantonello, L., Jedidi, K., & Schmitt, B. H. (2013). Functional and experiential routes to
persuasion: An analysis of advertising in emerging versus developed markets.
International Journal of Research in Marketing, 30(1), 46–56.

Excellent Product … But Too Early to Say: Consumer Reactions to Tentative Product Reviews

Kemafasu I, (2020), Excellent Product … But Too Early to Say: Consumer Reactions to Tentative Product Reviews, Journal of Interactive Marketing, 52, p35-p51.

https://www.sciencedirect.com/science/article/abs/pii/S1094996820300785

Mots clés : Examens en ligne, Expertise des sources, Expérience des produits, Certitude des attitudes, Exhaustivité des informations

Résumé : Cette recherche explore les effets de la tentation dans les critiques de produits en ligne sur la certitude de l’attitude du produit des consommateurs et les intentions comportementales. En s’appuyant sur la théorie de la saillance, la théorie de l’attribution et le travail dans la certitude d’attitude, on voit que, lorsque les consommateurs qui ont vu des critiques positives d’un produit sont exposés à une évaluation provisoire, leur certitude et leur volonté d’acheter sont réduites. On prédit également que les réactions des consommateurs diffèrent en fonction de l’expertise de la source d’avis ainsi que de l’expérience produit du consommateur.

Est abordée également la confiance dans l’exhaustivité des informations en tant que mécanisme métacognitif qui explique l’effet de révision provisoire. Plus précisément, on soutient que les consommateurs qui voient un examen provisoire sont sensibilisés aux informations potentiellement manquantes, ce qui réduit leur certitude et leur volonté d’achat.

Les hypothèses sont testées dans une série d’expériences qui démontrent que la timidité réduit la certitude et la volonté d’achat, mais que l’effet est atténué lorsque l’évaluateur est un novice et lorsque le consommateur a un niveau élevé d’expérience du produit.

Grandes lignes :

  • Un examen provisoire se traduit par une certitude et des intentions d’achat inférieures à un examen positif, négatif ou mixte
  • Le fait que ce soit provisoire se traduit par une diminution de la confiance des consommateurs dans l’exhaustivité des informations.
  • L’effet d’un avis provisoire est diminué lorsque l’examinateur provisoire est perçu comme un novice.

Les consommateurs qui ont une faible expertise produit sont davantage influencés par un examen provisoire que ceux qui ont une expertise produit plus élevée

Ajzen, I. (1991). The theory of planned behavior. Organizational Behavior and
Human Decision Processes, 50(2), 179–211.
Alba, J. W., & Hutchinson, J. W. (1987). Dimensions of consumer expertise.
Journal of Consumer Research, 13(4), 411–454.
Anderson, C. (2007). The long tail: How endless choice is creating unlimited
demand. Random House.
Babić, R. A., Sotgiu, F., De Valck, K., & Bijmolt, T. H. A. (2016). The effect of
electronic word-of-mouth on sales: A meta-analytic review of platform,
product, and metric factors. Journal of Marketing Research, 53(3), 297–318.
Banerjee, S., Bhattacharyya, S., & Bose, I. (2017). Whose online reviews to
trust? Understanding reviewer trustworthiness and its impact on business.
Decision Support Systems, 96, 17–26.
Cacioppo, J. T., & Petty, R. E. (1982). The need for cognition. Journal of
Personality and Social Psychology, 42(1), 116.
Casaló, L. V., Flavián, C., Guinalíu, M., & Ekinci, Y. (2015). Avoiding the dark
side of positive online consumer reviews: Enhancing reviews’ usefulness for
high risk-averse travelers. Journal of Business Research, 68(9), 1829–1835.
Chevalier, J. A., Dover, Y., & Mayzlin, D. (2018). Channels of impact: User
reviews when quality is dynamic and managers respond. Marketing Science,
37(5), 688–709.
Chiou, J.-S., Hsiao, C.-C., & Chiu, T.-Y. (2018). The credibility and attribution
of online reviews: Differences between high and low product knowledge
consumers. Online Information Review, 42(5), 630–646.
Choi, S., & Mattila, A. S. (2018). The effect of experience congruity on
repurchase intention: The moderating role of public commitment. Service
Science, 10(2), 124–138.
Flemming, D., Cress, U., & Kimmerle, J. (2017). User comments about research
findings: how Conflictual information in online science journalistic articles
influences laypeople’s understanding of scientific tentativeness. Communications, 42(4), 465–480.
Flemming, D., Feinkohl, I., Cress, U., & Kimmerle, J. (2015). Individual
uncertainty and the uncertainty of science: The impact of perceived conflict
and general self-efficacy on the perception of tentativeness and credibility of
scientific information. Frontiers in Psychology, 6, 1859.
Floyd, K., Freling, R., Alhoqail, S., Cho, H. Y., & Freling, T. (2014). How
online product reviews affect retail sales: A meta-analysis. Journal of
Retailing, 90(2), 217–232.
Folse, J. A. G., Porter III, M., Godbole, M. B., & Reynolds, K. E. (2016). The
effects of negatively Valenced emotional expressions in online reviews on
the reviewer, the review, and the product. Psychology & Marketing, 33(9),
747–760.
Forbes-Riley, K., & Litman, D. (2011). Benefits and challenges of real-time
uncertainty detection and adaptation in a spoken dialogue computer tutor.
Speech Communication, 53(9–10), 1115–1136.
Forman, C., Ghose, A., & Wiesenfeld, B. (2008). Examining the relationship
between reviews and sales: The role of reviewer identity disclosure in
electronic markets. Information Systems Research, 19(3), 291–313.
Hamilton., Ryan., Kathleen D. Vohs., & Ann L. McGill. (2014). We’ll be
honest, this won’t be the best article you’ll ever read: The use of dispreferred
markers in word-of-mouth communication.. Journal of Consumer
Research, 41(1), 197–212.
Häfner, M., & Trampe, D. (2009). When thinking is beneficial and when it is
not: The effects of thin and round advertising models. Journal of Consumer
Psychology, 19(4), 619–628.
Hair, M., & Ozcan, T. (2018). How reviewers’ use of profanity affects perceived
usefulness of online reviews. Marketing Letters, 29(2), 151–163.
Hassan, S., Tantithamthavorn, C., Bezemer, C.-P., & Hassan, A. E. (2018).
Studying the dialogue between users and developers of free apps in the
Google play store. Empirical Software Engineering, 23(3), 1275–1312.
Hayes, A. F. (2013). Introduction to Mediation, Moderation, and Conditional
Process Analysis: A Regression-Based Approach. New York, NY: The
Guilford Press.
Ho-Dac, N. N., Carson, S. J., & Moore, W. L. (2013). The effects of positive
and negative online customer reviews: Do brand strength and category
maturity matter? Journal of Marketing, 77(6), 37–53.
Hyland, K. (1996). Writing without conviction? Hedging in science research
articles. Applied linguistics, 17(4), 433–454.
Jensen, M. L., Averbeck, J. M., Zhu, Z., & Wright, K. B. (2013). Credibility of
anonymous online product reviews: A language expectancy perspective.
Journal of Management Information Systems, 30(1), 293–324.
Jiménez, F. R., & Mendoza, N. A. (2013). Too popular to ignore: The influence
of online reviews on purchase intentions of search and experience products.
Journal of Interactive Marketing, 27(3), 226–235.
Kardes, F. R., Posavac, S. S., & Cronley, M. L. (2004). Consumer inference: A
review of processes, bases, and judgment contexts. Journal of Consumer
Psychology, 14(3), 230–256.
Kardes, F. R., Posavac, S. S., Silvera, D., Cronley, M. L., Sanbonmatsu, D. M.,
& Schertzer, S., et al (2006). Debiasing omission neglect. Journal of
Business Research, 59(6), 786–792.
Karmarkar, U. R., & Tormala, Z. L. (2009). Believe me, I have no idea what I’m
talking about: The effects of source certainty on consumer involvement and
persuasion. Journal of Consumer Research, 36(6), 1033–1049.
Koçaş, C., & Akkan, C. (2016). A system for pricing the sales distribution from
blockbusters to the long tail. Decision Support Systems, 89, 56–65.
Lederman, N. G., & O’Malley, M. (1990). Students’ perceptions of tentativeness
in science: Development, use, and sources of change. Science Education, 74
(2), 225–239.
Lee, S., & Ro, H. (2016). The impact of online reviews on attitude changes: The
differential effects of review attributes and consumer knowledge. International Journal of Hospitality Management, 56, 1–9.
Ludwig, S., De Ruyter, K., Friedman, M., Brüggen, E. C., Wetzels, M., &
Pfann, G. (2013). More than words: The influence of affective content and
linguistic style matches in online reviews on conversion rates. Journal of
Marketing, 77(1), 87–103.
McAuley, J., Pandey, R., & Leskovec, J. (2015). Inferring networks of
substitutable and complementary products. Proceedings of the 21th ACM
SIGKDD International Conference on Knowledge Discovery and Data
Mining. ACM, 785–794.
McGinnies, E., & Ward, C. D. (1980). Better liked than right: Trustworthiness
and expertise as factors in credibility. Personality and Social Psychology
Bulletin, 6(3), 467–472.
Minnema, A., Bijmolt, T. H. A., Gensler, S., & Wiesel, T. (2016). To keep or
not to keep: Effects of online customer reviews on product returns. Journal
of Retailing, 92(3), 253–267.
Mishra, S., U. N. Umesh., & Donald E. Stem Jr. (1993). Antecedents of the
attraction effect: An information-processing approach. Journal of Marketing
Research, 30(3), 331–349.
Mitchell, A. A., & Dacin, P. A. (1996). The assessment of alternative measures
of consumer expertise. Journal of Consumer Research, 23(3), 219–239.
Moore, S. G. (2015). Attitude predictability and helpfulness in online reviews:
The role of explained actions and reactions. Journal of Consumer Research,
42(1), 30–44.
Mudambi, S. M., & Schuff, D. (2010). What makes a helpful review? A study of
customer reviews on Amazon.Com. MIS Quarterly, 34(1), 185–200.
Nam, M., Wang, J., & Lee, A. Y. (2012). The difference between differences:
How expertise affects diagnosticity of attribute alignability. Journal of
Consumer Research, 39(4), 736–750.
Petty, R. E., & Brinol, P. (2008). Persuasion: From single to multiple to
metacognitive processes. Perspectives on Psychological Science, 3(2), 137–147.
Pfeiffer, B. E., Deval, H., Kardes, F. R., Ewing, D. R., Han, X., & Cronley, M.
L. (2014). Effects of construal level on omission detection and multiattribute
evaluation. Psychology and Marketing, 31(11), 992–1007.
Picazo-Vela, S., Chou, S. Y., Melcher, A. J., & Pearson, J. M. (2010). Why
provide an online review? An extended theory of planned behavior and the
role of big-five personality traits. Computers in Human Behavior, 26(4),
685–696.
Poddar, A., Banerjee, S., & Sridhar, K. (2017). False advertising or slander?
Using location based tweets to assess online rating-reliability. Journal of
Business Research, 99, 390–397.
Preacher, K. J., Rucker, D. D., & Hayes, A. F. (2007). Addressing moderated
mediation hypotheses: Theory, methods, and prescriptions. Multivariate
Behavioral Research, 42(1), 185–227.
50 K. Ifie / Journal of Interactive Marketing 52 (2020) 35–51
Qiu, L., Pang, J., & Lim, K. H. (2012). Effects of conflicting aggregated rating
on EWOM review credibility and diagnosticity: The moderating role of
review valence. Decision Support Systems, 54(1), 631–643.
Rucker, D. D., Petty, R. E., & Pablo, B. (2008). What’s in a frame anyway?: A
meta‐cognitive analysis of the impact of one versus two sided message framing
on attitude certainty. Journal of Consumer Psychology, 18(2), 137–149.
Rucker, D. D., Tormala, Z. L., Petty, R. E., & Briñol, P. (2014). Consumer
conviction and commitment: An appraisal-based framework for attitude
certainty. Journal of Consumer Psychology, 24(1), 119–136.
Schlosser, A. E. (2011). Can including pros and cons increase the helpfulness
and persuasiveness of online reviews? The interactive effects of ratings and
arguments. Journal of Consumer Psychology, 21(3), 226–239.
Schwartz, R., & Lederman, N. (2008). What scientists say: Scientists’ views of
nature of science and relation to science context. International Journal of
Science Education, 30(6), 727–771.
Sen, S., & Lerman, D. (2007). Why are you telling me this? An examination into
negative consumer reviews on the web. Journal of Interactive Marketing, 21
(4), 76–94.
Sheppard, B. H., Hartwick, J., & Warshaw, P. R. (1988). The theory of reasoned
action: A meta-analysis of past research with recommendations for
modifications and future research. Journal of Consumer Research, 15(3),
325–343.
Shoham, M., Moldovan, S., & Steinhart, Y. (2017). Positively useless:
Irrelevant negative information enhances positive impressions. Journal of
Consumer Psychology, 27(2), 147–159.
Skowronski, J. J., & Carlston, D. E. (1989). Negativity and extremity biases in
impression formation: A review of explanations. Psychological Bulletin,
105(1), 131–142.
Smith, S. M., Fabrigar, L. R., MacDougall, B. L., & Wiesenthal, N. L. (2008).
The role of amount, cognitive elaboration, and structural consistency of
attitude-relevant knowledge in the formation of attitude certainty. European
Journal of Social Psychology, 38(2), 280–295.
Snehasish, B. (2017). Study of Authentic and Fictitious Online Reviews
(Unpublished Doctoral dissertation).
Tang, T., Fang, E., & Wang, F. (2014). Is neutral really neutral? The effects of
neutral user-generated content on product sales. Journal of Marketing, 78
(4), 41–58.
Taylor, S. E., & Thompson, S. C. (1982). Stalking the elusive vividness effect.
Psychological Review, 89, 155–181.
Tormala, Z. L., & Rucker, D. D. (2018). Attitude certainty: Antecedents,
consequences, and new directions. Consumer Psychology Review, 1(1),
72–89.
Wan, E. W., Rucker, D. D., Tormala, Z. L., & Clarkson, J. J. (2010). The effect
of regulatory depletion on attitude certainty. Journal of Marketing Research,
47(3), 531–541.
Webster, D. M., & Kruglanski, A. W. (1994). Individual differences in need for
cognitive closure. Journal of Personality and Social Psychology, 67(6),
1049.
Willemsen, L. M., Neijens, P. C., & Bronner, F. (2012). The ironic effect of
source identification on the perceived credibility of online product
reviewers. Journal of Computer-Mediated Communication, 18(1), 16–31.
Wu, L., Shen, H., Li, M., & Deng, Q. (2017). Sharing information now vs later:
The effect of temporal contiguity cue and power on consumer response
toward online reviews. International Journal of Contemporary Hospitality
Management, 29(2), 648–668.
Xie, H. J., Miao, L., Kuo, P.-J., & Lee, B.-Y. (2011). Consumers’ responses to
ambivalent online hotel reviews: The role of perceived source credibility
and pre-decisional disposition. International Journal of Hospitality
Management, 30(1), 178–183.
Yin, D., Bond, S., & Zhang, H. (2014). Anxious or angry? Effects of discrete
emotions on the perceived helpfulness of online reviews. MIS Quarterly, 38
(2), 539–560.
Zhu, F., & Zhang, X. (2010). Impact of online consumer reviews on sales: The
moderating role of product and consumer characteristics. Journal of
Marketing, 74(2), 133–148.