Zhuang W, Cui G, Peng L, (2018), Manufactured opinions: The effect of manipulating online product reviews, Journal of Business Research, Volume 87, June 2018, Pages 24-35

https://www.sciencedirect.com/science/article/abs/pii/S0148296318300912

Mots clés : Avis de produits en ligne, Manipulation, Soupçon, Persuasion, Commerce électronique

Résumé : Des recherches antérieures supposent que les consommateurs peuvent détecter et ignorer la manipulation des avis sur les produits en ligne ou sont inconscients de telles pratiques. Nous supposons que l’équilibre se produit en raison des signaux de manipulation, de la suspicion des consommateurs et de leur expertise. Notre analyse des données sur l’occupation des hôtels montre que l’effet de l’ajout d’avis positifs et de la suppression d’avis négatifs sur les ventes présente une courbe en U inversée. De plus, les marques faibles souffrent davantage d’un ajout excessif. Nos expériences en laboratoire montrent que l’ajout affecte l’intention d’achat du consommateur, mais il suscite également des soupçons, ce qui exerce un effet médiateur négatif. La suppression est plus déguisée et difficile à soupçonner. Les novices sont plus influencés par les manipulations que leurs homologues expérimentés. Un ajout excessif entraîne la méfiance des consommateurs et peut se retourner contre eux. La suppression exacerbe l’asymétrie d’information et entraîne une sélection défavorable, ce qui justifie la retenue et la réglementation.

Grandes lignes :

• Un ajout excessif entraîne la méfiance des consommateurs et peut se retourner contre eux. 
• La suppression est plus déguisée et difficile à soupçonner. 
• La suppression exacerbe l’asymétrie d’information et entraîne une sélection défavorable, ce qui justifie la retenue et la réglementation.

Ahluwalia, R., & Burnkrant, R. E. (2004). Answering questions about questions: A persuasion knowledge perspective for understanding the effects of rhetorical questions.
Journal of Consumer Research, 31(1), 26–42.
Akerlof, G. A., & Shiller, R. J. (2015). Phishing for phools: The economics of manipulation
and deception. Princeton University Press.
Anderson, E. T., & Simester, D. I. (2014). Reviews without a purchase: Low ratings, loyal
customers, and deception. Journal of Marketing Research, 51(3), 249–269.
Anderson, M., & Magruder, J. (2012). Learning from the crowd: Regression discontinuity
estimates of the effects of an online review database. The Economic Journal, 122(563),
957–989.
Campbell, M. C., & Kirmani, A. (2000). Consumers’ use of persuasion knowledge: The
effects of accessibility and cognitive capacity on perception of an influence agent.
Journal of Consumer Research, 27(1), 69–83.
Chen, Y., Wang, Q., & Xie, J. (2011). Online social interactions: A natural experiment on
word of mouth versus observational learning. Journal of Marketing Research, 48(2),
238–254.
Cui, G., Lui, H. K., & Guo, X. (2012). The effect of online consumer reviews on new
product sales. International Journal of Electronic Commerce, 17(1), 39–57.
Darke, P. R., & Ritchie, R. J. B. (2007). The defensive consumer: Advertising deception,
defensive processing, and distrust. Journal of Marketing Research, 44(1), 114–127.
Dellarocas, C. (2006). Strategic manipulation of internet opinion forums: Implications for
consumers and firms. Management Science, 52(10), 1577–1593.
Dellarocas, C., Zhang, M. X., & Awad, N. F. (2007). Exploring the value of online product
reviews in forecasting sales: The case of motion pictures. Journal of Interactive
Marketing, 21(4), 23–45.
Einwiller, S. A., Fedorikhin, A., Johnson, A. R., & Kamins, M. A. (2006). Enough is enough! When identification no longer prevents negatve corporate associations. Journal
of the Academy of Marketing Science, 34(2), 185–194.
Filieri, R. (2015). What makes online reviews helpful? A diagnosticity-adoption framework to explain informational and normative influences in e-WOM. Journal of
Business Research, 68(6), 1261–1270.
Finkle, J.. The emerging ‘Fake Fan’ economy. (2013). Retrieved from http://www.
businessspectator.com.au/article/2013/8/19/technology/emerging-fake-faneconomy (accessed 18 May 2014).
Friestad, M., & Wright, P. (1994). The persuasion knowledge model: How people cope
with persuasion attempts. Journal of Consumer Research, 21(1), 1–31.
Fulmer, I. S., Barry, B., & Long, D. A. (2009). Lying and smiling: Informational and
emotional deception in negotiation. Journal of Business Ethics, 88(4), 691–709.
Gössling, S. C., Hall, M., & Andersson, A.-C. (2018). The manager’s dilemma: A conceptualization of online review manipulation strategies. Current Issues in Tourism,
21(5), 484–503.
Hayes, A. F., Preacher, K. J., & Myers, T. A. (2011). Mediation and the estimation of
M. Zhuang et al. Journal of Business Research 87 (2018) 24–35
34
indirect effects in political communication research. In E. P. Bucy, & R. L. Holbert
(Eds.). Sourcebook for political communication research: Methods, measures, and analytical techniques (pp. 434–465). New York: Routledge.
Ho-Dac, N. N., Carson, S. J., & Moore, W. L. (2013). The effects of positive and negative
online customer reviews: Do brand strength and category maturity matter? Journal of
Marketing, 77(6), 37–53.
Hu, N., Bose, I., Gao, Y., & Liu, L. (2011). Manipulation in digital word-of-mouth: A
reality check for book reviews. Decision Support Systems, 50(3), 627–635.
Hu, N., Bose, I., Koh, N. S., & Liu, L. (2012). Manipulation of online reviews: An analysis
of ratings, readability, and sentiments. Decision Support Systems, 52(3), 674–684.
Hu, N., Liu, L., & Sambamurthy, V. (2011). Fraud detection in online consumer reviews.
Decision Support Systems, 50(3), 614–626.
Jain, S. P., & Posavac, S. S. (2001). Prepurchase attribute verifiability, source credibility,
and persuasion. Journal of Consumer Psychology, 11(3), 169–180.
Jindal, N., & Liu, B. (2008). Opinion spam and analysis. Proceeding of International
Conference on Web Search and Data Mining, WSDM 08 (pp. 219–230). California:
Stanford University.
Kirmani, A. (1990). The effect of perceived advertising costs on brand perceptions.
Journal of Consumer Research, 17(2), 160–171.
Kirmani, A., & Zhu, J. R. (2007). Vigilant against manipulation: The effects of regulatory
focus on the use of persuasion knowledge. Journal of Marketing Research, 44(4),
688–701.
Lappas, T., Sabnis, G., & Valkanas, G. (2016). The impact of fake positive reviews on
online visibility: A vulnerability assessment of the hotel industry. Information Systems
Research, 27(4), 940–961.
Luca, M., & Zervas, G. (2016). Fake it till you make it: Reputation, competition, and Yelp
review fraud. Management Science, 62(12), 3412–3427.
Mayzlin, D. (2006). Promotional chat on the internet. Marketing Science, 25(2), 155–163.
Mayzlin, D., Dover, Y., & Chevalier, J. (2014). Promotional reviews: An empirical investigation of online review manipulation. American Economic Review, 104(8),
2421–2455.
McCornack, S. A., & Levine, T. R. (1990). When lies are uncovered: Emotional and relational outcomes of discovered deception. Communication Monographs, 57(2),
119–138.
Moorthy, S., & Hawkins, S. A. (2005). Advertising repetition and quality perception.
Journal of Business Research, 58(3), 354–360.
Morrison, P.. The Yelp wars: False reviews, slander and anti-SLAPP: What’s ethical in online
reviewing. (2011). Retrieved from http://www.scpr.org/programs/patt-morrison/
2011/08/25/20426/yelpamazonfakereviewcitysearchtripadvisorantislapp (Accessed
25 August 2013).
Northrup, L. (2009). Academic publisher pays professors for shill Amazon reviews.
Retrieved from http://consumerist.com/5313215/academic-publisher-paysprofessors-for-shill-amazon-reviews, Accessed date: 31 July 2009.
Pullig, C., Netemeyer, R. G., & Biswas, A. (2006). Attitude basis, certainty, and challenge
alignment: A case of negative brand publicity. 34(4), 528–542.
Quipp, J.. 50+ sites to help you bury negative posts about you or your company!. (2008).
Retrieved from http://www.searchenginepeople.com/blog/50-sites-to-help-youbury-negative-posts-about-you-oryour-company.htm (Accessed 25 August 2014).
Reimer, T., & Benkenstein, M. (2016). When good WOM hurts and bad WOM gains: The
effect of untrustworthy online reviews. Journal of Business Research, 69(12),
5993–6001.
Sen, S., & Lerman, D. (2007). Why are you telling me this? An examination into negative
consumer reviews on the web. Journal of Interactive Marketing, 21(4), 76–94.
Shu, S. B., & Carlson, K. A. (2014). When three charms but four alarms: Identifying the
optimal number of claims in persuasion settings. Journal of Marketing, 78(1),
127–139.
Smith, D., Menon, S., & Sivakumar, K. (2005). Online peer and editorial recommendations, trust, and choice in virtual markets. Journal of Interactive Marketing, 19(3),
15–37.
Snijders, T., & Bosker, R. J. (2012). Multilevel analysis: An introduction to basic and advanced multilevel modeling. Sage Publications.
Stiglitz, J. E. (2002). Information and the change in the paradigm in economics. The
American Economic Review, 92(3), 460–501.
Teixeira, T., Picard, R., & Kaliouby, R. (2014). Why, when and how much to entertain
consumers in advertisements? A web-based facial tracking field study. Marketing
Science, 33(6), 809–827.
Walther, J., Van Der Heide, B., Hamel, L. M., & Shulman, K. C. (2009). Self-generated
versus other-generated statements and impressions in computer-mediated communication: A test of warranting theory using Facebook. Communication Research, 36(2),
229–253.

Lee H, Hae Rim C, Lee D, (2019), Learning to rank products based on online product reviews using a hierarchical deep neural network, Electronic Commerce Research and Applications, 36.

https://www.sciencedirect.com/science/article/pii/S1567422319300511

Mots clés : Classement des produits, Avis de produits en ligne, Réseau neuronal profond hiérarchique

Résumé : Le classement des produits basé sur les évaluations de produits en ligne consiste à déduire les préférences relatives des utilisateurs entre différents produits en tant que variante de l’analyse des sentiments au niveau de l’entité. Malgré la relation complexe entre la préférence globale de l’utilisateur et les opinions diverses et individuelles, les approches existantes utilisent généralement des hypothèses empiriques sur les caractéristiques de sentiment des produits d’intérêt. Dans cet article, nous proposons une nouvelle approche unifiée pour apprendre à classer les produits en fonction des critiques de produits en ligne. Contrairement aux approches existantes, il utilise des techniques d’apprentissage approfondi pour extraire la représentation de révision latente de haut niveau qui contient les informations les plus sémantiques dans le processus d’apprentissage. Pour cette approche, nous étendons le réseau d’attention hiérarchique récemment proposé pour opérer dans le domaine du classement. Ce réseau apprend de manière hiérarchique les représentations optimales des fonctionnalités des produits et leurs avis grâce à l’utilisation d’encodeurs à deux niveaux basés sur l’attention. Pour construire un modèle de classement plus avancé, plusieurs fonctionnalités ont été ajoutées pour donner suffisamment d’informations sur les préférences relatives des utilisateurs, et deux fonctions représentatives de perte de classement, RankNet et ListNet, ont été appliquées. De plus, nous démontrons que ce réseau surpasse les méthodes existantes de prédiction du classement des ventes sur la base des évaluations de produits en ligne.

Appel, O., Chiclana, F., Carter, J., Fujita, H., 2016. A hybrid approach to the sentiment
analysis problem at the sentence level. Knowl.-Based Syst. 108, 110–124. https://doi.
org/10.1016/j.knosys.2016.05.040.
Bahdanau, D., Cho, K., Bengio, Y., 2015. Neural machine translation by jointly learning to
align and translate. arXiv:1409.0473.
Bashir, S., Afzal, W., Baig, A.R., 2016. Opinion-based entity ranking using learning to
rank. Appl. Soft Comput. 38, 151–163. https://doi.org/10.1016/j.asoc.2015.10.001..
URL: http://www.sciencedirect.com/science/article/pii/S156849461500616X.
Bickart, B., Schindler, R.M., 2001. Internet forums as influential sources of consumer
information. J. Interactive Market. 15, 31–40. https://doi.org/10.1002/dir.1014..
URL: http://www.sciencedirect.com/science/article/pii/S1094996801701843.
Burges, C., Shaked, T., Renshaw, E., Lazier, A., Deeds, M., Hamilton, N., Hullender, G.,

2005. Learning to rank using gradient descent. In: Proceedings of the 22nd international conference on Machine Learning. New York, NY, USA, pp. 89–96. https://doi.
      org/10.1145/1102351.1102363.
      Cao, Z., Qin, T., Liu, T.Y., Tsai, M.F., Li, H., 2007. Learning to rank: From pairwise approach to listwise approach. In: Proceedings of the 24th International Conference on
      Machine Learning. New York, NY, USA, pp. 129–136. https://doi.org/10.1145/
      1273496.1273513.
      Chen, T., Xu, R., He, Y., Wang, X., 2017. Improving sentiment analysis via sentence type
      classification using bilstm-crf and cnn. Expert Syst. Appl. 72, 221–230. https://doi.
      org/10.1016/j.eswa.2016.10.065.. URL: http://www.sciencedirect.com/science/
      article/pii/S0957417416305929.
      Cooijmans, T., Ballas, N., Laurent, C., Alar Gülehre, Courville, A., 2016. Recurrent batch
      normalization. arXiv:1603.09025.
      Decker, R., Trusov, M., 2010. Estimating aggregate consumer preferences from online
      product reviews. Int. J. Res. Mark. 27https://doi.org/10.1016/j.ijresmar.2010.09.
      001.. URL: http://www.sciencedirect.com/science/article/pii/
      S0167811610000753.
      Dellarocas, C., Zhang, X.M., Awad, N.F., 2007. Exploring the value of online product
      reviews in forecasting sales: the case of motion pictures. J. Interactive Market. 21,
      23–45. https://doi.org/10.1002/dir.20087.
      Engonopoulos, N., Lazaridou, A., Paliouras, G., Chandrinos, K., 2011. Els: a word-level
      method for entity-level sentiment analysis. In: Proceedings of the International
      Conference on Web Intelligence, Mining and Semantics. ACM, New York, NY, USA.
      https://doi.org/10.1145/1988688.1988703. pp. 12:1–12:9.
      Fan, Z.P., Che, Y.J., Chen, Z.Y., 2017. Product sales forecasting using online reviews and
      historical sales data: a method combining the bass model and sentiment analysis. J.
      Business Res. 74, 90–100. https://doi.org/10.1016/j.jbusres.2017.01.010.. URL:
      http://www.sciencedirect.com/science/article/pii/S0148296317300231.
      Ganesan, K., Zhai, C., 2012. Opinion-based entity ranking. Inform. Retrieval 15, 116–150.
      https://doi.org/10.1007/s10791-011-9174-8.
      Gerani, S., Mehdad, Y., Carenini, G., Ng, R.T., Nejat, B., 2014. Abstractive summarization
      of product reviews using discourse structure. In: Proceedings of the 2014 Conference
      on Empirical Methods in Natural Language Processing (EMNLP). Association for
      Computational, Linguistics, Doha, Qatar, pp. 1602–1613. URL: http://www.aclweb.
      org/anthology/D14-1168.
      He, R., McAuley, J., 2016. Ups and downs: Modeling the visual evolution of fashion
      trends with one-class collaborative filtering. In: Proceedings of the 25th International
      Conference on World Wide Web, International World Wide Web Conferences Steering
      Committee, Republic and Canton of Geneva Switzerland, pp. 507–517. https://doi.
      org/10.1145/2872427.2883037.
      Hennig-Thurau, T., Gwinner, K.P., Walsh, G., Gremler, D.D., 2004. Electronic word-ofmouth via consumer-opinion platforms: what motivates consumers to articulate
      themselves on the internet? J. Interactive Market. 18, 38–52. https://doi.org/10.
      1002/dir.10073.. URL: http://www.sciencedirect.com/science/article/pii/
      Table 5
      Top 10 highly weighted tokens in the testing set for sampled categories.
      Categories Top 10 tokens
      Action Figures & Statues grandson, tattoo, tock, momma, equipped, pterodactyl, detachable, husky, grace
      Camera & Photo portable, films, recycled, powerfull, film-, 5-pack, zoom, handycam, focus, spruce
      Cell Phones console, pros-, oversized, evolutionary, maturity, realllly, clearance, excellent, snaps, resistant
      Kitchen & Dining chalkboard, gauze, flex, Christian, gripping, shiny, terrier, wide, shipment, mistral
      Skin Care embrace, gland, popularity, inspiration, highlight, boron, frizz, revise, 5 min, spot
      H.-C. Lee, et al. Electronic Commerce Research and Applications 36 (2019) 100874
      9
      S1094996804700961.
      Huang, Z., Xu, W., Yu, K., 2015. Bidirectional lstm-crf models for sequence tagging.
      arXiv:1508.01991.
      Jannach, D., Resnick, P., Tuzhilin, A., Zanker, M., 2016. Recommender systems — beyond
      matrix completion. Commun. ACM 59, 94–102. https://doi.org/10.1145/2891406.
      Jindal, N., Liu, B., 2006. Identifying comparative sentences in text documents. In:
      Proceedings of the 29th Annual International ACM SIGIR Conference on Research
      and Development in Information Retrieval. ACM, New York, NY, USA, pp. 244–251.
      https://doi.org/10.1145/1148170.1148215.
      Kessler, W., Kuhn, J., 2013. Detection of product comparisons – how far does an out-ofthe-box semantic role labeling system take you? In: Proceedings of the 2013
      Conference on Empirical Methods in Natural Language Processing Association for
      Computational Linguistics, Seattle, Washington, USA, pp. 1892–1897. URL: http://
      www.aclweb.org/anthology/D13-1194.
      Kim, Y., 2014. Convolutional neural networks for sentence classification. In: Proceedings
      of the 2014 Conference on Empirical Methods in Natural Language Processing
      (EMNLP). Association for Computational, Linguistics, Doha, Qatar, pp. 1746–1751.
      URL: http://www.aclweb.org/anthology/D14-1181.
      Kingma, D.P., Ba, J., 2014. Adam: a method for stochastic optimization. arXiv:1412.6980.
      Liu, Q., Huang, H., Zhang, C., Chen, Z., Chen, J., 2013. Chinese comparative sentence
      identification based on the combination of rules and statistics. In: International
      Conference on Advanced Data Mining and Applicationspp. 300–310. https://doi.org/
      10.1007/978-3-642-53917-6_27.
      Liu, Y., 2006. Word of mouth for movies: its dynamics and impact on box office revenue.
      J. Marketing 70, 74–89. https://doi.org/10.1509/jmkg.70.3.74.
      Liu, Y., Bi, J.W., Fan, Z.P., 2017. Ranking products through online reviews: a method
      based on sentiment analysis technique and intuitionistic fuzzy set theory. Inform.
      Fusion 36, 149–161. https://doi.org/10.1016/j.inffus.2016.11.012.. URL: http://
      www.sciencedirect.com/science/article/pii/S1566253516301580.
      Liu, Y., Huang, X., An, A., Yu, X., 2007. Arsa: A sentiment-aware model for predicting
      sales performance using blogs. In: Proceedings of the 30th Annual International ACM
      SIGIR Conference on Research and Development in Information Retrieval. ACM, New
      York, NY, USA, pp. 607–614. https://doi.org/10.1145/1277741.1277845.
      Liu, Y., Huang, X., An, A., Yu, X., 2008. Modeling and predicting the helpfulness of online
      reviews. In: 2008 Eighth IEEE International Conference on Data Mining, IEEE, pp.
      443–452. https://doi.org/10.1109/ICDM.2008.94.. URL: https://ieeexplore.ieee.
      org/abstract/document/4781139.
      McAuley, J., Targett, C., Shi, Q., van den Hengel, A., 2015. Image-based recommendations on styles and substitutes. In: Proceedings of the 38th International ACM SIGIR
      Conference on Research and Development in Information Retrieval. ACM, New York,
      NY, USA, pp. 43–52. https://doi.org/10.1145/2766462.2767755.
      Najmi, E., Hashmi, K., Malik, Z., Rezgui, A., Khan, H.U., 2015. Capra: a comprehensive
      approach to product ranking using customer reviews. Computing 97, 843–867.
      https://doi.org/10.1007/s00607-015-0439-8.
      Raffel, C., Ellis, D.P.W., 2015. Feed-forward networks with attention can solve some longterm memory problems. arXiv:1512.08756.
      Romeo, S., Da San Martino, G., Barrón-Cedeno, A., Moschitti, A., Belinkov, Y., Hsu, W.N.,
      Zhang, Y., Mohtarami, M., Glass, J., 2016. Neural attention for learning to rank
      questions in community question answering. In: Proceedings of COLING 2016, the
      26th International Conference on Computational Linguistics: Technical Papers.
      Association for Computational, Linguistics, New York, NY, USA, pp. 1734–1745.
      URL: http://www.aclweb.org/anthology/C/C16/C16-1163.pdf.
      Saumya, S., Singh, J.P., Baabdullah, A.M., Rana, N.P., Dwivedi, Y.K., 2018. Ranking
      online consumer reviews. Electron. Commer. Res. Appl. 29, 78–89. https://doi.org/
      10.1016/j.elerap.2018.03.008.. URL: http://www.sciencedirect.com/science/
      article/pii/S1567422318300358.
      Schneider, M.J., Gupta, S., 2016. Forecasting sales of new and existing products using
      consumer reviews: A random projections approach. Int. J. Forecast. 32, 243–256.
      https://doi.org/10.1016/j.ijforecast.2015.08.005.. URL: http://www.sciencedirect.
      com/science/article/pii/S0169207015001235.
      Song, Y., Wang, H., He, X., 2014. Adapting deep ranknet for personalized search. In:
      Proceedings of the 7th ACM International Conference on Web Search and Data
      Mining. ACM, New York, NY, USA, pp. 83–92. https://doi.org/10.1145/2556195.
      2556234.
      Srivastava, N., Hinton, G., Krizhevsky, A., Sutskever, I., Salakhutdinov, R., 2014. Dropout:
      A simple way to prevent neural networks from overfitting. J. Mach. Learn. Res. 15,
      1929–1958. URL: http://jmlr.org/papers/v15/srivastava14a.html.
      Sun, J., Long, C., Zhu, X., Huang, M., 2009. Mining reviews for product comparison and
      recommendation. In: Polibitspp. 33–40. https://doi.org/10.1145/1148170.1148215.
      Varathan, K.D., Giachanou, A., Crestani, F., 2017. Comparative opinion mining: a review.
      J. Assoc. Inform. Sci. Technol. 68, 811–829. https://doi.org/10.1002/asi.23716.
      Wang, B., Klabjan, D., 2017. An attention-based deep net for learning to rank. arXiv:1702.
      06106.
      Wang, J., Zhao, W.X., He, Y., Li, X., 2015. Leveraging product adopter information from
      online reviews for product recommendation. In: Ninth International AAAI Conference
      on Web and Social Mediapp. 464–472. URL: https://www.aaai.org/ocs/index.php/
      ICWSM/ICWSM15/paper/view/10475.
      Wang, L., Ling, W., 2016. Neural network-based abstract generation for opinions and
      arguments. arXiv:1606.02785.
      Ward, C.B., Choi, Y., Skiena, S., Xavier, E.C., 2011. Empath: A framework for evaluating
      entity-level sentiment analysis. In: 2011 8th International Conference Expo on
      Emerging Technologies for a Smarter Worldpp. 1–6. https://doi.org/10.1109/
      CEWIT.2011.6135866.
      Xu, K., Ba, J., Kiros, R., Cho, K., Courville, A., Salakhudinov, R., Zemel, R., Bengio, Y.,
2006. Show, attend and tell: Neural image caption generation with visual attention.
      In: Bach, F., Blei, D. (Eds.), Proceedings of the 32nd International Conference on
      Machine Learning, PMLR Lille, France, pp. 2048–2057.
      Yagci, I.A., Das, S., 2014. Box office prediction based on microblog. Expert Syst. Appl. 41,
      1680–1689. https://doi.org/10.1016/j.eswa.2013.08.065.
      Yagci, I.A., Das, S., 2018. Measuring design-level information quality in online reviews.
      Electron. Commer. Res. Appl. 30, 102–110. https://doi.org/10.1016/j.elerap.2018.
      05.010.
      Yang, Z., Yang, D., Dyer, C., He, X., Smola, A., Hovy, E., 2016. Hierarchical attention
      networks for document classification. In: Proceedings of the 2016 Conference of the
      North American Chapter of the Association for Computational Linguistics: Human
      Language Technologies Association for Computational Linguistics, San Diego,
      California, pp. 1480–1489. URL: http://www.aclweb.org/anthology/N16-1174.
      Yu, J., Zha, Z.J., Wang, M., Chua, T.S., 2011. Aspect ranking: Identifying important
      product aspects from online consumer reviews. In: Proceedings of the 49th Annual
      Meeting of the Association for Computational Linguistics: Human Language
      Technologies, vol. 1. Association for Computational Linguistics, Stroudsburg, PA,
      USA, pp. 607–614. URL: http://dl.acm.org/citation.cfm?id=2002472.2002654.
      Zhang, K., Cheng, Y., Liao, W.K., Choudhary, A., 2011. Mining millions of reviews: A
      technique to rank products based on importance of reviews. In: Proceedings of the
      13th International Conference on Electronic Commerce. ACM, New York, NY, USA.
      https://doi.org/10.1145/2378104.2378116. pp. 12:1–12:8.
      Zhang, K., Narayanan, R., Choudhary, A., 2010. Voice of the customers: Mining online
      customer reviews for product feature-based ranking. In: Proceedings of the 3rd
      Wonference on Online Social Networks USENIX Association, Berkeley, CA, USA. pp.
      11–11. URL: http://dl.acm.org/citation.cfm?id=1863190.1863201.
      Zhang, Z., Guo, C., Goes, P., 2013. Product comparison networks for competitive analysis
      of online word-of-mouth. ACM Trans. Manage Inf. Syst. 3, 20:1–20:22. https://doi.
      org/10.1145/2407740.2407744.
      Zheng, L., Noroozi, V., Yu, P.S., 2017. Joint deep modeling of users and items using
      reviews for recommendation. In: Proceedings of the Tenth ACM International
      Conference on Web Search and Data Mining. ACM, New York, NY, USA, pp. 425–434.
      https://doi.org/10.1145/3018661.3018665.
      Zhu, F., Zhang, X.M., 2010. Impact of online consumer reviews on sales: The moderating
      role of product and consumer characteristics. J. Marketing 74, 133–148. https://doi.
      org/10.1509/jmkg.74.2.133. DOI: 10.1509/jmkg.74.2.133.

Song W, Li W, Geng S, (2020), Effect of online product reviews on third parties’ selling on retail platforms,  Electronic Commerce Research and Applications, 39.

https://www.sciencedirect.com/science/article/pii/S1567422319300778

Mots clés : Coopétition, Avis de produits en ligne, Effet plateforme, Vendeurs tiers, Plateforme de vente au détail

Résumé : Les détaillants en ligne ouvrent leurs plateformes pour inviter des vendeurs tiers à vendre directement sur leurs plateformes pour des commissions. Étant donné que la plupart des consommateurs prennent des décisions d’achat en utilisant les avis de produits en ligne comme référence, nous développons un modèle de théorie des jeux pour explorer l’impact des avis sur la décision d’un vendeur tiers de vendre sur une plateforme de vente au détail ouverte et sur le profit du détaillant de la plateforme. Sur la base de deux attributs de produit – qualité et ajustement – nous distinguons deux cas, la qualité domine l’ajustement et l’ajustement domine la qualité. Nous constatons que, dans le cadre d’avis symétriques (c.-à-d. D’avis ne favorisant ni le produit du détaillant ni celui d’un tiers), des avis plus élevés homogénéisent les produits, intensifiant ainsi la concurrence entre le détaillant et le tiers dans les domaines où la qualité domine. Cependant, même dans le cadre d’avis asymétriques, le tiers ne peut être incité à vendre sur la plateforme de vente au détail que si l’on considère la qualité des systèmes de révision du détaillant, ce qui peut entraîner un effet de plateforme sur les avis. L’effet de plateforme renforce l’importance des avis, de sorte qu’il puisse élargir la différenciation des produits créée par les avis asymétriques. En particulier, lorsque l’effet de plateforme et l’asymétrie des avis sont suffisamment élevés, le détaillant peut non seulement inciter le tiers à vendre sur sa plateforme, mais également bénéficier à la fois de la qualité domine l’ajustement et de l’ajustement domine la qualité.

Grandes lignes :

• Dans le cadre d’avis symétriques, des avis plus élevés homogénéisent les produits, intensifiant ainsi la concurrence entre le détaillant et le tiers
• L’effet de plateforme renforce l’importance des avis

La qualité domine l’ajustement et l’ajustement domine la qualité

Abhishek, V., Jerath, K., Zhang, Z. John, 2016. Agency selling or reselling? Channel
structures in electronic retailing. Manage. Sci. 62 (8), 2259–2280.
Adner, R., Chen, J., Zhu, F., 2019. Frenemies in platform markets: Heterogeneous profit
foci as drivers of compatibility decisions. Manage. Sci Forthcoming.
Anderson, E.W., 1998. Customer satisfaction and word of mouth. J. Service Res. 1 (1),
5–17.
Archak, Nikolay, Ghose, Anindya, Ipeirotis, Panagiotis G., 2011. Deriving the pricing
power of product features by mining consumer reviews. Manage. Sci. 57 (8),
1485–1509.
Chen, J., Guo, Z., 2016. New media advertising and retail platform openness. Working
Paper.
Chen, Y., Xie, J., 2008. Online consumer review: Word-of-mouth as a new element of
marketing communication mix. Manage. Sci. 54 (3), 477–491.
Chevalier, Judith A., Mayzlin, Dina, 2006. The effect of word of mouth on sales: Online
book reviews. J. Mark. Res. 43 (3), 345–354.
Dellarocas, Chrysanthos, 2006. Strategic manipulation of internet opinion forums:
Implications for consumers and firms. Manage. Sci. 52 (10), 1577–1593.
Forman, Chris, Ghose, Anindya, Wiesenfeld, Batia, 2008. Examining the relationship
between reviews and sales: The role of reviewer identity disclosure in electronic
markets. Inform. Syst. Res. 19 (3), 291–313.
Geng, S., Li, W., Qu, X., Chen, L., 2017. Design for the pricing strategy of return-freight
insurance based on online product reviews. Electron. Commer. Res. Appl. 25, 16–28.
Gutt, Dominik, Neumann, Jürgen, Zimmermann, Steffen, Kundisch, Dennis, Chen,
Jianqing, 2019. Design of review systems—A strategic instrument to shape online
reviewing behavior and economic outcomes. J. Strategic Inform. Syst. 28 (2),
104–117.
Hagiu, Andrei, Wright, Julian, 2015. Marketplace or reseller? Manage. Sci. 61 (1),
184–203.
Hao, Lin, Fan, Ming, 2014. An analysis of pricing models in the electronic book market.
MIS Q. 38 (4), 1017–1032.
Hu, Nan, Pavlou, Paul A., Zhang, Jennifer, 2006. Can online reviews reveal a product’s
true quality? empirical findings and analytical modeling of online word-of-mouth
communication. In: Proceedings of the 7th ACM conference on Electronic commerce,
pp. 324–330.
Jerath, Kinshuk, John Zhang, Z., 2010. Store within a store. J. Mark. Res. 47 (4),
748–763.
Kwark, Young, Chen, Jianqing, Raghunathan, Srinivasan, 2014. Online product reviews:
Implications for retailer and competing manufacturers. Inform. Syst. Res. 25 (1),
93–110.
Kwark, Y., Chen, J., Raghunathan, S., 2017. Platform or wholesale? A strategic tool for
online retailers to benefit from third-party information. MIS Q. 41 (3), 763–785.
Kwark, Young, Chen, Jianqing, Raghunathan, Srinivasan, 2018. User-generated content
and competing firms’ product design. Manage. Sci. 64 (10), 4608–4628.
Li, X., Hitt, L.M., 2008. Self-selection and information role of online product reviews.
Inform. Syst. Res. 19 (4), 456–474.
Li, X., Hitt, L.M., Zhang, Z.J., 2011. Product reviews and competition in markets for
repeat purchase products. J. Manage. Inform. Syst. 27 (4), 9–41.
Mantin, Benny, Krishnan, Harish, Dhar, Tirtha, 2014. The strategic role of third-party
marketplaces in retailing. Prod. Operations Manage. 23 (11), 1937–1949.
Mayzlin, Dina, 2006. Promotional chat on the internet. Marketing Sci. 25 (2), 155–163.
Moe, Wendy W., Trusov, Michael, 2011. The value of social dynamics in online product
ratings forums. J. Mark. Res. 48 (3), 444–456.
Ryan, J.K., Sun, D., Zhao, X., 2012. Competition and coordination in online marketplaces.
Prod. Operations Manage. 21 (6), 997–1014.
Sun, Monic, 2012. How does variance of product ratings matter? Manage. Sci. 58 (4),
696–707.
Tan, Y. (Ricky), Carrillo, J.E., 2017. Strategic analysis of the agency model for digital
goods. Prod. Operations Manage. 26 (4), 724–741.
Tian, L., Vakaharia, A.J., Tan, Y. (Ricky), Xu, Y., 2018. Marketplace, reseller, or hybrid:
Strategic analysis of an emerging e-commerce model. Prod. Operations Manage. 27
(8), 1595–1610.
Zhu, Feng, Zhang, Xiaoquan, 2010. Impact of online consumer reviews on sales: the
moderating role of product and consumer characteristics. J. Marketing 74 (2),
133–148.

Gallo I, Townsend I, Alegre I, (2019), Experiential product framing and its influence on the creation of consumer reviews, Journal of Business Research, 98, p177-p190.

https://www.sciencedirect.com/science/article/abs/pii/S0148296319300074

Mots clés : Marketing expérimental, Encadrement expérentiel, Critiques de produits, Le bouche à oreille

Résumé : Nous examinons comment le cadrage expérientiel, une tactique de marketing de plus en plus populaire, influence le comportement de révision des consommateurs. Le cadrage expérientiel est une stratégie de communication par laquelle les spécialistes du marketing décrivent un produit matériel comme s’il s’agissait d’une expérience, quelque chose que le consommateur vit, plutôt que de se concentrer sur les fonctionnalités et les attributs du produit. Sur la base de travaux antérieurs comparant la relation des consommateurs avec les produits à celle des expériences ainsi que des travaux antérieurs sur le comportement de révision des produits et le marketing expérientiel, nous émettons l’hypothèse que le cadrage expérientiel augmente la probabilité des consommateurs de revoir un produit. En effet, un examen des données ainsi que deux études en laboratoire montrent que le cadrage d’un produit comme une expérience est associé à une augmentation du bouche à oreille. Nos résultats soutiennent également notre processus proposé ; lorsque les produits sont conçus comme des expériences, les consommateurs les perçoivent comme plus personnels et auto-définis; cela augmente alors la probabilité pour le consommateur de s’engager dans l’activité d’auto-démonstration de l’examen des produits.

Grandes lignes :

• Le cadrage expérientiel augmente la probabilité des consommateurs de revoir un produit.
• Le cadrage d’un produit comme une expérience est associé à une augmentation du bouche à oreille
• Lorsque les produits sont conçus comme des expériences, les consommateurs les perçoivent comme plus personnels

Albert, N., Merunka, D., & Valette-Florence, P. (2013). Brand passion: Antecedents and
consequences. Journal of Business Research, 66(7), 904–909.
Alexandrov, A., Lilly, B., & Babakus, E. (2013). The effects of social- and self-motives on
the intentions to share positive and negative word of mouth. Journal of the Academy of
Marketing Science, 41(5), 531–546.
Anderson, E. W. (1998). Customer satisfaction and word of mouth. Journal of Service
Research, 1(1), 5–17.
Babic Rosario, A., Sotgiu, F., De Valck, K., & Bijmolt, T. H. (2016). The effect of electronic
word of mouth on sales: A meta-analytic review of platform, product, and metric
factors. Journal of Marketing Research, 53(3), 297–318.
Belk, R. W. (1988). Possessions and the extended self. Journal of Consumer Research,
15(3), 139–168.
Berger, J. (2013). Contagious: Why things catch on. New York, NY: Simon and Schuster.
Berger, J. (2014). Word of mouth and interpersonal communication: A review and directions for future research. Journal of Consumer Psychology, 24(4), 586–607.
Berger, J., & Milkman, K. L. (2012). What makes online content viral? Journal of
Marketing Research, 49(2), 192–205.
Brakus, J. J., Schmitt, B. H., & Zarantonello, L. (2009). Brand Experience: What is it? How
is it measured? Does it affect loyalty? Journal of Marketing, 73(3), 52–68.
Bughin, J., Doogan, J., & Vetvik, O. J. (2010). A new way to measure word-of-mouth
marketing. The McKinsey Quarterly, 2, 113–116.
Caprariello, P. A., & Reis, H. T. (2013). To do, to have, or to share? Valuing experiences
over material possessions depends on the involvement of others. Journal of Personality
and Social Psychology, 104(2), 199–215.
Carter, T. J., & Gilovich, T. (2010). The relative relativity of experiential and material
purchases. Journal of Personality and Social Psychology, 98, 146–159.
Carter, T. J., & Gilovich, T. (2012). I am what I do, not what I have: The differential
centrality of experiential and material purchases to the self. Journal of Personality and
Social Psychology, 102(6), 1304–1317.
Chazin, S. M. (2007). Marketing Apple: 5 secrets of the world’s best marketing machine.
Retrieved from http://www.MarketingApple.com.
Chen, Z. (2017). Social acceptance and word of mouth: How the motive to belong leads to
divergent WOM with strangers and friends. Journal of Consumer Research. https://doi.
org/10.1093/jcr/ucx055.
Chen, Z., & Berger, J. (2016). How content acquisition method affects word of mouth.
Journal of Consumer Research, 43(1), 86–102.
Chung, C., & Darke, P. (2006). The consumer as advocate: Self-relevance, culture, and
word of-mouth. Marketing Letters, 17, 269–279.
Csikszentmihalyi, M., & Rochberg-Halton, E. (1981). The meaning of things: Domestic
symbols and the self. Cambridge, UK: Cambridge University Press.
De Matos, C. A., & Rossi, C. A. V. (2008). Word-of-mouth communications in marketing: A
meta-analytic review of the antecedents and moderators. Journal of the Academy of
Marketing Science, 36(4), 578–596.
Dichter, E. (1966). How word of mouth advertising works. Harvard Business Review, 44(6),
147–166.
Dubois, D., Bonezzi, A., & De Angelis, M. (2016). Sharing with friends versus strangers:
How interpersonal closeness influences word-of-mouth valence. Journal of Marketing
Research, 53(5), 712–727.
Dunn, E. W., & Weidman, A. C. (2014). Building a science of spending: Lessons from the
past and directions for the future. Journal of Consumer Psychology, 25(1), 172–178.
Elliot, S. (2013, September 23). Ads for rosewood hotels hope to convey a sense of place.
The New York Times. Retrieved from http://www.nytimes.com/.
Engel, J. F., Blackwell, R. D., & Miniard, P. W. (1993). Consumer behavior (8th ed.). Fort
Worth: Dryden Press.
Escalas, J. E. (2007). Self-referencing and persuasion: Narrative transportation versus
analytical elaboration. Journal of Consumer Research, 33, 421–429.
Gallo, I., Escalas, J., & Sood, S. (2018). Transported through time: The importance of narrative processing, transportation, and consistency on experiential purchases compared to
material purchases (Working Paper)IESE Business School.
Gallo, I., Sood, S., Mann, T. C., & Gilovich, T. (2016). The heart and the head: On choosing
experiences intuitively and possessions deliberatively. Journal of Behavioral Decision
Making, 30, 754–768.
Gentile, C., Spiller, N., & Noci, G. (2007). How to sustain the customer experience: An
overview of experience components that co-create value with the customer. European
Management Journal, 25(5), 395–410.
Gilovich, T., Kumar, A., & Jampol, L. (2015). The beach, the bikini, and the best buy:
Replies to Dunn and Weidman, and to Schmitt, Brakus, and Zarantonello. Journal of
Consumer Psychology, 25(1), 179–184.
Godes, D., & Mayzlin, D. (2009). Firm-created word-of-mouth communication: Evidence
from a field test. Marketing Science, 28, 721–739.
Godes, D., Mayzlin, D., Chen, Y., Das, S., Dellarocas, C., Pfeiffer, B., … Verlegh, P. (2005).
The firm’s management of social interactions. Marketing Letters, 16(3–4), 415–428.
Gummesson, E. (1995). Relationship marketing. Gower handbook of marketing. 4.
Hayes, A. F. (2013). Introduction to mediation, moderation, and conditional process analysis:
A regression-based approach. New York, NY: Guilford Press.
Hennig-Thurau, T., Gwinner, K. P., Walsh, G., & Gremler, D. D. (2004). Electronic wordof-mouth via consumer-opinion platforms: What motivates consumers to articulate
themselves on the internet? Journal of Interactive Marketing, 18, 38–52.
Holbrook, M. B., & Hirschman, E. C. (1982). The experiential aspects of consumption:
Consumer fantasies, feelings, and fun. Journal of Consumer Research, 9(2), 132–140.
Inman, J. J., & Zeelenberg, M. (2002). Regret in repeat purchase versus switching decisions: The attenuating role of decision justifiability. Journal of Consumer Research,
29(1), 116–128.
Jain, S. P., & Posavac, S. S. (2001). Prepurchase attribute verifiability, source credibility,
and persuasion. Journal of Consumer Psychology, 11, 169–180.
I. Gallo et al. Journal of Business Research 98 (2019) 177–190
189
King, R. A., Racherla, P., & Bush, V. D. (2014). What we know and don’t know about
online word-of-mouth: A review and synthesis of the literature. Journal of Interactive
Marketing, 28(3), 167–183.
Kumar, A., & Gilovich, T. (2015). Some “thing” to talk about? Differential story utility
from experiential and material purchases. Personality and Social Psychology Bulletin,
41(10), 1320–1331.
LaSalle, D., & Britton, T. A. (2003). Priceless. Turning ordinary products into extraordinary
experiences. Boston, MA: Harvard Business School Press.
Lovett, M. J., Peres, R., & Shachar, R. (2013). On brands and word of mouth. Journal of
Marketing Research, 50(4), 427–444.
Maxham, J. G., III (2001). Service recovery’s influence on consumer satisfaction, positive
word-of-mouth, and purchase intentions. Journal of Business Research, 54(1), 11–24.
Mazzarol, T., Sweeney, J. C., & Soutar, G. N. (2007). Conceptualizing word-of-mouth
activity, triggers and conditions: An exploratory study. European Journal of Marketing,
41(11/12), 1475–1494.
McAdams, D. P. (2001). The psychology of life stories. Review of General Psychology, 5(2),
100–122.
Mittal, B. (1999). The advertising of services: Meeting the challenge of intangibility.
Journal of Service Research, 2, 98–116.
Muniz, A. M., Jr., & O’Guinn, T. C. (2001). Brand community. Journal of Consumer
Research, 27, 412–432.
Myers, E. (1985). Phenomenological analysis of the importance of special possessions: An
exploratory study. Advances in Consumer Research, 12, 560–565.
Nelson, P. (1970). Information and consumer behavior. Journal of Political Economy, 78,
311–329.
Newman, A. A. (2012, March 7). Marketers promoting a granola bar hit the trails in
national parks. The New York Times. Retrieved from http://www.nytimes.com/.
Nicolao, L., Irwin, J. R., & Goodman, J. K. (2009). Happiness for sale: Do experiential
purchases make consumers happier than material purchases? Journal of Consumer
Research, 36, 188–198.
Nielsen (2015, October 2). Word-of-mouth recommendations remain the most credible.
Retrieved from http://www.nielsen.com.
Nysveen, H., Pedersen, P. E., & Skard, S. (2013). Brand Experiences in service organizations: exploring the individual effects of brand experience dimensions. Journal of
Brand Management, 20(5).
Packard, G., Gershoff, A., & Wooten, D. B. (2016). When boastful word of mouth helps
versus hurts social perceptions and persuasion. Journal of Consumer Research, 43(1),
26–43.
Pan, Y., & Zhang, J. Q. (2011). Born unequal: A study of the helpfulness of user-generated
product reviews. Journal of Retailing, 87(4), 598–612.
Pine, B., & Gilmore, J. H. (1999). The experience economy. Boston, MA: Harvard Business
School Press.
Rimé, B. (2009). Emotion elicits the social sharing of emotion: Theory and empirical
review. Emotion Review, 1, 60–85.
Rust, R. T., & Cooil, B. (1994). Reliability measures for qualitative data: Theory and
implications. Journal of Marketing Research, 1–14.
Schmitt, B., Brakus, J., & Zarantonello, L. (2015). From experiential psychology to consumer experience. Journal of Consumer Psychology, 25(1), 166–171.
Schmitt, B. H. (1999). Experiential marketing: How to get customers to sense, feel, think, act,
and relate to your company and brands. New York: Free Press.
Schmitt, B. H. (2010). Customer experience management: A revolutionary approach to connecting with your customers. New Jersey: John Wiley & Sons.
Sundaram, D. S., Mitra, K., & Webster, C. (1998). Word-of-mouth communications: A
motivational analysis. Advances in Consumer Research, 25, 527–531.
Trusov, M., Bucklin, R. E., & Pauwels, K. (2009). Effects of word-of-mouth versus traditional marketing: Findings from an internet social networking site. Journal of
Marketing, 73(5), 90–102.
Tuškej, U., Golob, U., & Podnar, K. (2013). The role of consumer-brand identification in
building brand relationships. Journal of Business Research, 66(1), 53–59.
Van Boven, L., Campbell, M. C., & Gilovich, T. (2010). Stigmatizing materialism: On
stereotypes and impressions of materialistic and experiential pursuits. Personality and
Social Psychology Bulletin, 36(4), 551–563.
Van Boven, L., & Gilovich, T. (2003). To do or to have? That is the question. Journal of
Personality and Social Psychology, 85(6), 1193–1202.
Wallendorf, M., & Arnould, E. J. (1988). My favorite things: A cross-cultural inquiry into
object attachment, possessiveness, and social linkage. Journal of Consumer Research,
14, 531–547.
Wilson, A. E., & Ross, M. (2003). The identity function of autobiographical memory: Time
is on our side. Memory, 11(2), 137–149.
Wojnicki, A. C., & Godes, D. (2008). Word-of-mouth as self-enhancement (Working paper)
Rotman School of Management, University of Toronto.
Wright, A. A., & Lynch, J. G. (1995). Communication effects of advertising versus direct
experience when both search and experience attributes are present. Journal of
Consumer Research, 21, 708–718.
Yeh, Y., & Choi, S. M. (2011). MINI-lovers, maxi-mouths: An investigation of antecedents
to eWOM intention among brand community members. Journal of Marketing
Communications, 17(3), 145–162.
You, Y., Vadakkepatt, G. G., & Joshi, A. M. (2015). A meta-analysis of electronic word-ofmouth elasticity. Journal of Marketing, 79(2), 19–39.
Zarantonello, L., Jedidi, K., & Schmitt, B. H. (2013). Functional and experiential routes to
persuasion: An analysis of advertising in emerging versus developed markets.
International Journal of Research in Marketing, 30(1), 46–56.

Kemafasu I, (2020), Excellent Product … But Too Early to Say: Consumer Reactions to Tentative Product Reviews, Journal of Interactive Marketing, 52, p35-p51.

https://www.sciencedirect.com/science/article/abs/pii/S1094996820300785

Mots clés : Examens en ligne, Expertise des sources, Expérience des produits, Certitude des attitudes, Exhaustivité des informations

Résumé : Cette recherche explore les effets de la tentation dans les critiques de produits en ligne sur la certitude de l’attitude du produit des consommateurs et les intentions comportementales. En s’appuyant sur la théorie de la saillance, la théorie de l’attribution et le travail dans la certitude d’attitude, on voit que, lorsque les consommateurs qui ont vu des critiques positives d’un produit sont exposés à une évaluation provisoire, leur certitude et leur volonté d’acheter sont réduites. On prédit également que les réactions des consommateurs diffèrent en fonction de l’expertise de la source d’avis ainsi que de l’expérience produit du consommateur.

Est abordée également la confiance dans l’exhaustivité des informations en tant que mécanisme métacognitif qui explique l’effet de révision provisoire. Plus précisément, on soutient que les consommateurs qui voient un examen provisoire sont sensibilisés aux informations potentiellement manquantes, ce qui réduit leur certitude et leur volonté d’achat.

Les hypothèses sont testées dans une série d’expériences qui démontrent que la timidité réduit la certitude et la volonté d’achat, mais que l’effet est atténué lorsque l’évaluateur est un novice et lorsque le consommateur a un niveau élevé d’expérience du produit.

Grandes lignes :

• Un examen provisoire se traduit par une certitude et des intentions d’achat inférieures à un examen positif, négatif ou mixte
• Le fait que ce soit provisoire se traduit par une diminution de la confiance des consommateurs dans l’exhaustivité des informations.
• L’effet d’un avis provisoire est diminué lorsque l’examinateur provisoire est perçu comme un novice.

Les consommateurs qui ont une faible expertise produit sont davantage influencés par un examen provisoire que ceux qui ont une expertise produit plus élevée

Ajzen, I. (1991). The theory of planned behavior. Organizational Behavior and
Human Decision Processes, 50(2), 179–211.
Alba, J. W., & Hutchinson, J. W. (1987). Dimensions of consumer expertise.
Journal of Consumer Research, 13(4), 411–454.
Anderson, C. (2007). The long tail: How endless choice is creating unlimited
demand. Random House.
Babić, R. A., Sotgiu, F., De Valck, K., & Bijmolt, T. H. A. (2016). The effect of
electronic word-of-mouth on sales: A meta-analytic review of platform,
product, and metric factors. Journal of Marketing Research, 53(3), 297–318.
Banerjee, S., Bhattacharyya, S., & Bose, I. (2017). Whose online reviews to
trust? Understanding reviewer trustworthiness and its impact on business.
Decision Support Systems, 96, 17–26.
Cacioppo, J. T., & Petty, R. E. (1982). The need for cognition. Journal of
Personality and Social Psychology, 42(1), 116.
Casaló, L. V., Flavián, C., Guinalíu, M., & Ekinci, Y. (2015). Avoiding the dark
side of positive online consumer reviews: Enhancing reviews’ usefulness for
high risk-averse travelers. Journal of Business Research, 68(9), 1829–1835.
Chevalier, J. A., Dover, Y., & Mayzlin, D. (2018). Channels of impact: User
reviews when quality is dynamic and managers respond. Marketing Science,
37(5), 688–709.
Chiou, J.-S., Hsiao, C.-C., & Chiu, T.-Y. (2018). The credibility and attribution
of online reviews: Differences between high and low product knowledge
consumers. Online Information Review, 42(5), 630–646.
Choi, S., & Mattila, A. S. (2018). The effect of experience congruity on
repurchase intention: The moderating role of public commitment. Service
Science, 10(2), 124–138.
Flemming, D., Cress, U., & Kimmerle, J. (2017). User comments about research
findings: how Conflictual information in online science journalistic articles
influences laypeople’s understanding of scientific tentativeness. Communications, 42(4), 465–480.
Flemming, D., Feinkohl, I., Cress, U., & Kimmerle, J. (2015). Individual
uncertainty and the uncertainty of science: The impact of perceived conflict
and general self-efficacy on the perception of tentativeness and credibility of
scientific information. Frontiers in Psychology, 6, 1859.
Floyd, K., Freling, R., Alhoqail, S., Cho, H. Y., & Freling, T. (2014). How
online product reviews affect retail sales: A meta-analysis. Journal of
Retailing, 90(2), 217–232.
Folse, J. A. G., Porter III, M., Godbole, M. B., & Reynolds, K. E. (2016). The
effects of negatively Valenced emotional expressions in online reviews on
the reviewer, the review, and the product. Psychology & Marketing, 33(9),
747–760.
Forbes-Riley, K., & Litman, D. (2011). Benefits and challenges of real-time
uncertainty detection and adaptation in a spoken dialogue computer tutor.
Speech Communication, 53(9–10), 1115–1136.
Forman, C., Ghose, A., & Wiesenfeld, B. (2008). Examining the relationship
between reviews and sales: The role of reviewer identity disclosure in
electronic markets. Information Systems Research, 19(3), 291–313.
Hamilton., Ryan., Kathleen D. Vohs., & Ann L. McGill. (2014). We’ll be
honest, this won’t be the best article you’ll ever read: The use of dispreferred
markers in word-of-mouth communication.. Journal of Consumer
Research, 41(1), 197–212.
Häfner, M., & Trampe, D. (2009). When thinking is beneficial and when it is
not: The effects of thin and round advertising models. Journal of Consumer
Psychology, 19(4), 619–628.
Hair, M., & Ozcan, T. (2018). How reviewers’ use of profanity affects perceived
usefulness of online reviews. Marketing Letters, 29(2), 151–163.
Hassan, S., Tantithamthavorn, C., Bezemer, C.-P., & Hassan, A. E. (2018).
Studying the dialogue between users and developers of free apps in the
Google play store. Empirical Software Engineering, 23(3), 1275–1312.
Hayes, A. F. (2013). Introduction to Mediation, Moderation, and Conditional
Process Analysis: A Regression-Based Approach. New York, NY: The
Guilford Press.
Ho-Dac, N. N., Carson, S. J., & Moore, W. L. (2013). The effects of positive
and negative online customer reviews: Do brand strength and category
maturity matter? Journal of Marketing, 77(6), 37–53.
Hyland, K. (1996). Writing without conviction? Hedging in science research
articles. Applied linguistics, 17(4), 433–454.
Jensen, M. L., Averbeck, J. M., Zhu, Z., & Wright, K. B. (2013). Credibility of
anonymous online product reviews: A language expectancy perspective.
Journal of Management Information Systems, 30(1), 293–324.
Jiménez, F. R., & Mendoza, N. A. (2013). Too popular to ignore: The influence
of online reviews on purchase intentions of search and experience products.
Journal of Interactive Marketing, 27(3), 226–235.
Kardes, F. R., Posavac, S. S., & Cronley, M. L. (2004). Consumer inference: A
review of processes, bases, and judgment contexts. Journal of Consumer
Psychology, 14(3), 230–256.
Kardes, F. R., Posavac, S. S., Silvera, D., Cronley, M. L., Sanbonmatsu, D. M.,
& Schertzer, S., et al (2006). Debiasing omission neglect. Journal of
Business Research, 59(6), 786–792.
Karmarkar, U. R., & Tormala, Z. L. (2009). Believe me, I have no idea what I’m
talking about: The effects of source certainty on consumer involvement and
persuasion. Journal of Consumer Research, 36(6), 1033–1049.
Koçaş, C., & Akkan, C. (2016). A system for pricing the sales distribution from
blockbusters to the long tail. Decision Support Systems, 89, 56–65.
Lederman, N. G., & O’Malley, M. (1990). Students’ perceptions of tentativeness
in science: Development, use, and sources of change. Science Education, 74
(2), 225–239.
Lee, S., & Ro, H. (2016). The impact of online reviews on attitude changes: The
differential effects of review attributes and consumer knowledge. International Journal of Hospitality Management, 56, 1–9.
Ludwig, S., De Ruyter, K., Friedman, M., Brüggen, E. C., Wetzels, M., &
Pfann, G. (2013). More than words: The influence of affective content and
linguistic style matches in online reviews on conversion rates. Journal of
Marketing, 77(1), 87–103.
McAuley, J., Pandey, R., & Leskovec, J. (2015). Inferring networks of
substitutable and complementary products. Proceedings of the 21th ACM
SIGKDD International Conference on Knowledge Discovery and Data
Mining. ACM, 785–794.
McGinnies, E., & Ward, C. D. (1980). Better liked than right: Trustworthiness
and expertise as factors in credibility. Personality and Social Psychology
Bulletin, 6(3), 467–472.
Minnema, A., Bijmolt, T. H. A., Gensler, S., & Wiesel, T. (2016). To keep or
not to keep: Effects of online customer reviews on product returns. Journal
of Retailing, 92(3), 253–267.
Mishra, S., U. N. Umesh., & Donald E. Stem Jr. (1993). Antecedents of the
attraction effect: An information-processing approach. Journal of Marketing
Research, 30(3), 331–349.
Mitchell, A. A., & Dacin, P. A. (1996). The assessment of alternative measures
of consumer expertise. Journal of Consumer Research, 23(3), 219–239.
Moore, S. G. (2015). Attitude predictability and helpfulness in online reviews:
The role of explained actions and reactions. Journal of Consumer Research,
42(1), 30–44.
Mudambi, S. M., & Schuff, D. (2010). What makes a helpful review? A study of
customer reviews on Amazon.Com. MIS Quarterly, 34(1), 185–200.
Nam, M., Wang, J., & Lee, A. Y. (2012). The difference between differences:
How expertise affects diagnosticity of attribute alignability. Journal of
Consumer Research, 39(4), 736–750.
Petty, R. E., & Brinol, P. (2008). Persuasion: From single to multiple to
metacognitive processes. Perspectives on Psychological Science, 3(2), 137–147.
Pfeiffer, B. E., Deval, H., Kardes, F. R., Ewing, D. R., Han, X., & Cronley, M.
L. (2014). Effects of construal level on omission detection and multiattribute
evaluation. Psychology and Marketing, 31(11), 992–1007.
Picazo-Vela, S., Chou, S. Y., Melcher, A. J., & Pearson, J. M. (2010). Why
provide an online review? An extended theory of planned behavior and the
role of big-five personality traits. Computers in Human Behavior, 26(4),
685–696.
Poddar, A., Banerjee, S., & Sridhar, K. (2017). False advertising or slander?
Using location based tweets to assess online rating-reliability. Journal of
Business Research, 99, 390–397.
Preacher, K. J., Rucker, D. D., & Hayes, A. F. (2007). Addressing moderated
mediation hypotheses: Theory, methods, and prescriptions. Multivariate
Behavioral Research, 42(1), 185–227.
50 K. Ifie / Journal of Interactive Marketing 52 (2020) 35–51
Qiu, L., Pang, J., & Lim, K. H. (2012). Effects of conflicting aggregated rating
on EWOM review credibility and diagnosticity: The moderating role of
review valence. Decision Support Systems, 54(1), 631–643.
Rucker, D. D., Petty, R. E., & Pablo, B. (2008). What’s in a frame anyway?: A
meta‐cognitive analysis of the impact of one versus two sided message framing
on attitude certainty. Journal of Consumer Psychology, 18(2), 137–149.
Rucker, D. D., Tormala, Z. L., Petty, R. E., & Briñol, P. (2014). Consumer
conviction and commitment: An appraisal-based framework for attitude
certainty. Journal of Consumer Psychology, 24(1), 119–136.
Schlosser, A. E. (2011). Can including pros and cons increase the helpfulness
and persuasiveness of online reviews? The interactive effects of ratings and
arguments. Journal of Consumer Psychology, 21(3), 226–239.
Schwartz, R., & Lederman, N. (2008). What scientists say: Scientists’ views of
nature of science and relation to science context. International Journal of
Science Education, 30(6), 727–771.
Sen, S., & Lerman, D. (2007). Why are you telling me this? An examination into
negative consumer reviews on the web. Journal of Interactive Marketing, 21
(4), 76–94.
Sheppard, B. H., Hartwick, J., & Warshaw, P. R. (1988). The theory of reasoned
action: A meta-analysis of past research with recommendations for
modifications and future research. Journal of Consumer Research, 15(3),
325–343.
Shoham, M., Moldovan, S., & Steinhart, Y. (2017). Positively useless:
Irrelevant negative information enhances positive impressions. Journal of
Consumer Psychology, 27(2), 147–159.
Skowronski, J. J., & Carlston, D. E. (1989). Negativity and extremity biases in
impression formation: A review of explanations. Psychological Bulletin,
105(1), 131–142.
Smith, S. M., Fabrigar, L. R., MacDougall, B. L., & Wiesenthal, N. L. (2008).
The role of amount, cognitive elaboration, and structural consistency of
attitude-relevant knowledge in the formation of attitude certainty. European
Journal of Social Psychology, 38(2), 280–295.
Snehasish, B. (2017). Study of Authentic and Fictitious Online Reviews
(Unpublished Doctoral dissertation).
Tang, T., Fang, E., & Wang, F. (2014). Is neutral really neutral? The effects of
neutral user-generated content on product sales. Journal of Marketing, 78
(4), 41–58.
Taylor, S. E., & Thompson, S. C. (1982). Stalking the elusive vividness effect.
Psychological Review, 89, 155–181.
Tormala, Z. L., & Rucker, D. D. (2018). Attitude certainty: Antecedents,
consequences, and new directions. Consumer Psychology Review, 1(1),
72–89.
Wan, E. W., Rucker, D. D., Tormala, Z. L., & Clarkson, J. J. (2010). The effect
of regulatory depletion on attitude certainty. Journal of Marketing Research,
47(3), 531–541.
Webster, D. M., & Kruglanski, A. W. (1994). Individual differences in need for
cognitive closure. Journal of Personality and Social Psychology, 67(6),
1049.
Willemsen, L. M., Neijens, P. C., & Bronner, F. (2012). The ironic effect of
source identification on the perceived credibility of online product
reviewers. Journal of Computer-Mediated Communication, 18(1), 16–31.
Wu, L., Shen, H., Li, M., & Deng, Q. (2017). Sharing information now vs later:
The effect of temporal contiguity cue and power on consumer response
toward online reviews. International Journal of Contemporary Hospitality
Management, 29(2), 648–668.
Xie, H. J., Miao, L., Kuo, P.-J., & Lee, B.-Y. (2011). Consumers’ responses to
ambivalent online hotel reviews: The role of perceived source credibility
and pre-decisional disposition. International Journal of Hospitality
Management, 30(1), 178–183.
Yin, D., Bond, S., & Zhang, H. (2014). Anxious or angry? Effects of discrete
emotions on the perceived helpfulness of online reviews. MIS Quarterly, 38
(2), 539–560.
Zhu, F., & Zhang, X. (2010). Impact of online consumer reviews on sales: The
moderating role of product and consumer characteristics. Journal of
Marketing, 74(2), 133–148.

Ouiddad S, Sidmou M. L, (2017), L’influence des avis en ligne sur l’intention d’achat du consommateur des produits de l’hébergement touristique : une proposition de typologie des consommateurs marocains, Question de Management, 2017/3, n°18, pp139-pp153.

Mots-clefs : bouche à oreille électronique, communication, information, variable, crédibilité

Résumé : Cet article a pour objectif de déterminer l’influence du bouche à oreille électronique plus particulièrement dans le secteur du voyage. Les avis en ligne sont l’une des formes du bouche à oreille électronique fournissant des informations aux consommateurs. Ces avis sont généralement considérés comme plus crédibles que les communications des entreprises.

Selon cette études les avantages d’une communication bouche à oreille électronique sont :

1. “Elle facilite l’accès au type et à la quantité de l’information voulue et associée aux différentes attributions des produits offerts
2. Elle augmente la facilité de comparaison et d’évaluation des différentes alternatives proposées aux acheteurs
3. Elle améliore la qualité de l’information reçue de la part du consommateur en comparant ses sources
4. Elle permet d’organiser et de structurer l’information”

L’étude définit également des variables expliquant le comportement d’achat des consommateurs suite à la consultation d’avis en ligne. Ces variables sont définies en quatre groupes : des variables liées au message, des variables liées au consommateur, des variables liées à la perception du consommateur du l’émetteur du message, et les variables de la réponse comportementale.

Conclusion : L’étude se conclut en indiquant que le bouche à oreille électronique a une influence différente selon les types de profils des récepteurs de l’avis lu. Cet article a ainsi définit des variables liées aux caractéristiques du message, qui déterminent la crédibilité de l’émetteur du message, la confiance, la crédibilité du site web, l’influence interpersonnelle.

L’étude définit ensuite les profils de récepteur de l’avis. Le premier profil correspond à des utilisateurs consultant régulièrement des avis et forums, généralement de jeune âge mais expérimentés sur internet. Ils sont plus en capacité de déterminer et repérer les faux avis.
Le deuxième profil de récepteur correspond à une catégorie définie de “hédonistes cartésiens”. Ce profil est généralement très attentif aux avis, il scrute et est attentifs à tous les commentaires. Ils pensent pouvoir vérifier la crédibilité des commentaires et avis grâce à leur expérience en matière de consultation d’avis en ligne.
Le dernier profil est définit comme “promeneurs”, il s’agit d’une catégorie d’individus représentant la majorité de l’échantillon. Ce profil d’individu considère les avis et forums comme essentiels dans sa phase d’achat, il sera plus découragé par les avis négatifs, véridiques ou non.

Sources :

• ANRT (2016), Enquête de collecte des indicateurs TIC auprès des ménages et des individus pour l’année 2015, 12^e édition, Rapport de l’Agence Nationale de Réglementation des Télécommunications.
• Arsal, I., Backman, S. et Baldwin, E. (2008), Influence of an online travel community on travel decisions. In P. O’Connor, W. Höpken & U. Gretzel (Eds.), Information and Communication Technologies in Tourism 2008 (pp. 82-93). New York : Springer Wien.
• Babin, J., Darden, W.R et Griffin, M. (1994), Work and/or Fun : Measuring Hedonic and Utilitarian Shopping Value, Journal of Consumer Research, 20 (March), 644-656.
• Bahri-Ammari N. et Zitouni M. (2016). Les communautés virtuelles de marque : le rôle de l’engagement du consommateur dans le développement de la fidélité et le bouche à oreille. In Proceedings of the Marketing Spring Colloquy (Vol. 7, 2016, pp : 242-260). URAM
• Bearden, W.O. et Etzel, M.J. (1982), Reference group influence on product and brand purchase, Journal of Consumer Research, 9, p. 183-194.
• Bertrandias, L. (2006), Sélection et influence des sources personnelles d’information du consommateur, Thèse de doctorat d’Etat es sciences de gestion, Université des sciences sociales de Toulouse, Institut d’Administration des entreprises.
• Bickart, B. et Schindler, R.M. (2001), Internet forums as influential sources of consumer information, Journal of Interactive Marketing, 15 (Summer), pp. 31–40.
•  Biétry, F. et Laroche, P. (2011), L’implication dans l’organisation, le syndicat et/ou la carrière, Revue de Gestion des Ressources Humaines ; Paris 81 (Jul-Sep 2011) : 19-38,77,79.
• Brousseau, A.D., Couvreur, A. et Loisel, J.P. (2003), Opinions et comportements des consommateurs : Un nouvel indicateur « situations de vie », Exploitation des enquêtes Consommation, CREDOC, Cahier de recherche N°188, Paris.
• Carricano, M., Poujol, F. et Bertrandias, L. (2010), Analyse de données avec SPSS, Pearson Education France, Paris, 2^e édition 2010 – 248 pages
• Cheung, C. M. K., Lee, M. K. O. et Rabjohn, N. (2008), The impact of electronic word-of-mouth. Internet Research, 18(3), 229.
• Cheung, C.M.K. et Thadani, D.R. (2010), The effectiveness of word-of-mouth communication : A literature analysis. Paper presented at 23rd Bled eConference eTrust : Implications for the Individual, Enterprises and Society, Bled, Slovenia.
• Cheung, M., Luo, C., Sia, C. et Chen, H. (2009), Credibility of Electronic Word-ofMouth : Informational and Normative Determinants of On-line Consumer Recommendations. International Journal of Electronic Commerce, 13(4), 9.
• Chevlier, J.A. et Mayzlin D. (2006), The Effect of Word of Mouth on Sales : Online Book Reviews, Journal of Marketing Research, 43, 3, 345–354.
• Creusier, J. et Biétry, F. (2014). Analyse comparative des méthodes de classifications : l’exemple du bien-être au travail. Revue Interdisciplinaire Management et Humanisme. Vol 10. P 114-133.
• Dellarocas, C. Zhang, X. et Awad, N. (2007), Exploring the value of online product reviews in forecasting sales : The case of motion pictures. Journal of Interactive Marketing, 21, 4, 23-45.
• Doh, S. J. et Hwang, J. S. (2009), How Consumers Evaluate eWOM (Electronic Wordof-Mouth) Messages. Cyberpsychology & Behavior, 12(2), 193-197.
• Duan, W., Gu, B., & Whinston, A. (2008). The dynamics of online word-of-mouth and product sales-an empirical investigation of the movie industry. Journal of Retailing, 84(2), 233-244
• Gretzel, U., et Yoo, K. H. (2008), Use and impact of online travel reviews. In P. O’Connor, W. Höpken & U. Gretzel (Eds.), Information and Communication Technologies in Tourism 2008, pp. 35-46, New York : Springer Wien.
• Hagel III J. et Armstrong A. (1997), Net Gain, Boston, MA : Harvard Business School Press
• Hennig-Thurau, T., Qwinner, K., Walsh, G., & Gremier, D. (2004). Electronic word of mouth via consumer opinions platforms : What motivates consumers to articulate themselves on the internet. Journal of interactive Marketing, 18(1), 38-52.
• Hovland, C.I. et Weiss, W. (1951), The influence of source credibility on communication effectiveness, Public Opinion Quarterly, 15, 4, pp. 635-650.
• Kempf, D.S. (1999), Attitude formation from product trial : distinct role of cognition and affect for hedonic and functional products, Psychology Marketing, Vol 16, janvier, pp.35-50.
• Kiecker, P. et Cowles, D. (2001), Interpersonal Communication and Personal Influence on the Internet : A Framework for Examining Online Word-of-Mouth. Internet Applications in Euromarketing, 11(2), 71-88.
• Ling, J. (2010), Intention to use online social networks for travel purposes : A case study at three Bangkok-based universities. AU-GSB e-Journal, Vol. 3, No.2, pp.50-59.
• Lange-Faria, W. et Elliot, S. (2012), Understanding the role of social media in destination marketing, Tourismos : an international multidisciplinary journal of tourism, Volume 7, Number 1, Spring-Summer 2012, pp. 193-211. Litvin, S. W., Goldsmith, R. E., et Pan, B. (2008), Electronic word-of-mouth in hospitality and tourism management, Tourism Management, 29(3), 458-468.
• Mendes-Filho, L. et Tan, F. B. (2009), User-generated content and consumer empowerment in the travel industry : a uses & gratifications and dual-process conceptualization, PACIS 2009 Proceedings. Paper 28.
• Nelson, P. (1970), Information and consumer behavior. Journal of Political Economy, 78(2), pp. 311–329. Munzel, A. and Kunz, W.H. (2014), “Creators, multipliers and lurkers : who contributes and who benefits at online review sites”, Journal of Service Management, Vol. 25 No. 1, pp. 3-3.
• Ouiddad, S., Sidmou, M.L. (2013), « Le pourvoir d’influence du bouche-à-oreille électronique : quels enjeux pour l’industrie de l’hébergement touristique marocaine », Revue La Cible, AFITEP, N°120, 1^er trimestre 2013, pp. 16-21.
• Park, D. H. et Kim, S. (2008). The effects of consumer knowledge on message processing of electronic word-of – mouth via online consumer reviews. Electronic Commerce Research and Applications, 7(4), 399-410.
• Schindler, R.M. et Bickart, B. (2005), Published Word of Mouth : Referable, Consumer-Generated Information on the Internet, Online Consumer Psychology : Understanding and Influencing Consumer Behavior in the Virtual World, C.P. in Haugtvedt, K.A. Machleit, and R.F. Yalch (eds.), Hillsdale, NJ : Lawrence Erlbaum Associates, pp. 35-61.
• Senecal, S. et Nantel J. (2004), The Influence of Online Product Recommendations on Consumers’ Online Choices, Journal of Retailing, 80, 1, pp. 159-169.
• Srarfi-Tabbane, R. et Hamouda, M. (2012), Impact du bouche à oreille électronique sur l’intention d’achat : cas du consommateur tunisien, 2nd International Symposium ISKO-MAGHREB, November 3d – 4th, Hammamet, Tunisia.
• Stockdale, R. et Borovicka, M. (2006), Developing an online business community : A travel industry case study. Paper presented at the 39th Annual Hawaii International Conference on System Sciences (HICSS’06).
• Vernette, E. (2002), Le rôle et le profil des leaders d’opinion pour la diffusion de l’Internet, Décisions Marketing, 25, 1, pp.37-51.
• Xiang, Z. et Gretzel, U. (2010), Role of social media in online travel information search. Tourism Management, Vol. 31, No.2, pp.179-188.
• YAYLI, A et BAYRAM, M. (2010), eWOM : The Effects of Online Consumer Review of Purchasing Decision Of Electronic Goods, Marketing Trends 
• Yoo B. et Donthu N. (2001), Developing and validating a multidimensional consumer-based brand equity scale, Journal of Business Research, 52, 1, 1-1.

Deng W., Ming Yi M., Lu Y., (2020), Vote or not? How various information cues affect helpfulness voting of online reviews, Online Information Review, Vol. 44

Mots-clefs : avis, notes, consommateur, vote d’utilité initiale, vote d’utilité cumulative, attributs, indices heuristiques, indices systématiques.

Résumé : Cet article a pour but de définir et d’étudier les facteurs influencent et déterminant les notes en ligne des consommateurs. L’article se concentre plus particulièrement sur les notes attribuées à des commentaires et avis de produits en ligne. Ces notes ayant pour but de diriger le consommateur vers les avis les plus utiles et les plus sérieux. Les notes attribuées aux avis s’opposent ainsi aux avis classés de facon chronologique qui n’offrent que des possibilités inégales d’obtenir un vote.
En effet, un vote pertinent ne recevra peut être pas suffisamment de notes pour être utile au consommateur car le classement chronologique l’éloigne. Cette étude tente ainsi de comprendre comment ces notes d’avis fonctionnent.

L’auteur indique, suite à ses recherches, que les notes peuvent être influencées par les notes précédentes. Il définit deux étapes du processus de vote : “le vote d’utilité initiale” qui se réfère à une situation où l’avis n’est pas encore évalué, il s’agit donc de la première note. La deuxième étape est le “vote d’utilité cumulative” qui cette fois concerne une situation dans laquelle il existe au minimum déjà une note. Les notes précédentes peuvent donc influencer la note future.

L’auteur définit que les votes d’utilité initiale et cumulatif sont influencés par le nombre de mots et les attributs du produit.

Conclusion : Le système de notation d’un avis a pour but de simplifier la démarche du consommateur et de l’aider à mesurer la qualité des évaluations en trouvant les avis utiles plus rapidement et facilement. Cependant cette étude remet en cause l’efficacité de cette pratique et de ce mécanisme. Elle indique que plusieurs facteurs influencent le processus de vote agrégé des évaluations en ligne.
L’étude définit deux étapes précédemment définie : “le vote d’utilité initiale” et le “vote d’utilité cumulative” qui n’ont pas les mêmes effets et causes car le vote cumulatif peut être influencé par les votes déjà existants.
Les indices heuristiques (évaluation des produits, comptage des mots) et systématiques (attributs des produits dans le contenu textuel) ont un impact plus important sur les deux étapes de votes.

Sources :

Abirami, A.M. and Askarunisa, A. (2017), “Sentiment analysis model to emphasize the impact of online reviews in healthcare industry”, Online Information Review, Vol. 41 No. 4, pp. 471-486.

Axsom, D., Yates, S. and Chaiken, S. (1987), “Audience response as a heuristic cue in persuasion”, Journal of Personality and Social Psychology, Vol. 53 No. 1, pp. 30-40.

Bohner, G., Moskowitz, G.B. and Chaiken, S. (1995), “The interplay of heuristic and systematic processing of social information”, European Review of Social Psychology, Vol. 6 No. 1, pp. 33-68.

Chaiken, S. and Ledgerwood, A. (2012), “A theory of heuristic and systematic information processing”, in Lange, P.A.M.V., Kruglanski, A.W. and Higgins, E.T. (Eds), Handbook of Theories of Social Psychology, SAGE Publications, London, Vol. 1, pp. 246-267.

Chaiken, S., Liberman, A. and Eagly, A.H. (1989), “Heuristic and systematic information processing within and beyond the persuasion context”, in Uleman, J.S. and Bargh, J.A. (Eds), Unintended Thought, Guilford, New York, pp. 212-252.

Chen, S. and Chaiken, S. (1999), “The heuristic–systematic model in its broader context”, in Chaiken, S. and Trope, Y. (Eds), Dual-Process Theories in Social Psychology, Guilford, New York, pp. 73-96.

Chen, Z. and Lurie, N.H. (2013), “Temporal contiguity and negativity bias in the impact of online word of mouth”, Journal of Marketing Research, Vol. 50 No. 4, pp. 463-476.

Chen, S., Duckworth, K. and Chaiken, S. (1999), “Motivated heuristic and systematic processing”, Psychological Inquiry, Vol. 10 No. 1, pp. 44-49.

Cheng, Y.H. and Ho, H.Y. (2015), “Social influence’s impact on reader perceptions of online reviews”, Journal of Business Research, Vol. 68 No. 4, pp. 883-887.

Cheung, C.M.K. and Thadani, D.R. (2012), “The impact of electronic word-of-mouth communication: a literature analysis and integrative model”, Decision Support Systems, Vol. 54 No. 1, pp. 461-470.

Cheung, C.M.K., Lee, M.K.O. and Rabjohn, N. (2008), “The impact of electronic word-of-mouth”, Internet Research, Vol. 18 No. 3, pp. 229-247.

Cheung, M.Y., Sia, C.L. and Kuan, K.K.Y. (2012), “Is this review believable? A study of factors affecting the credibility of online consumer reviews from an ELM perspective”, Journal of the Association for Information Systems, Vol. 13 No. 8, pp. 618-635.

Chua, A.Y. and Banerjee, S. (2016), “Helpfulness of user-generated reviews as a function of review sentiment, product type and information quality”, Computers in Human Behavior, Vol. 54, pp. 547-554.

CNNIC (2015), “2014 China online travel booking market research report”, pp. 18-21, available at: http://www.cnnic.net.cn/hlwfzyj/hlwxzbg/lxgb/201507/P020150715651462758347.pdf//2018-8-20.

Constantiou, I., Hoebel, N. and Zicari, R.V. (2012), “How do framing strategies influence the user’s choice of content on the web?”, Concurrency and Computation: Practice and Experience, Vol. 24 No. 17, pp. 2207-2220.

Costa, A.F., Traina, A.J.M., Jr, C.T. and Faloutsos, C. (2016), “Vote-and-comment: modeling the coevolution of user interactions in social voting web sites”, 2016 IEEE 16th International Conference on Data Mining (ICDM), Barcelona, pp. 91-100.

Danescu-Niculescu-Mizil, C., Kossinets, G., Kleinberg, J. and Lee, L. (2009), “How opinions are received by online communities: a case study on Amazon.com helpfulness votes”, WWW ’09 Proceedings of the 18th International Conference on World Wide Web, New York, ACM Press, pp. 141-150.

Davis, J.M. and Agrawal, D. (2018), “Understanding the role of interpersonal identification in online review evaluation: an information processing perspective”, International Journal of Information Management, Vol. 38 No. 1, pp. 140-149.

Ferran, C. and Watts, S. (2008), “Videoconferencing in the field: a heuristic processing model”, Social Science Electronic Publishing, Vol. 54 No. 9, pp. 1565-1578.

Fiske, S.T. and Taylor, S.E. (1991) [1984], Social Cognition, 2nd ed., McGraw-Hill, New York.

Ghose, A. and Ipeirotis, P.G. (2011), “Estimating the helpfulness and economic impact of product reviews: mining text and reviewer characteristics”, Social Science Electronic Publishing, Vol. 23 No. 10, pp. 1498-1512.

Godes, D. and Mayzlin, D. (2004), “Using online conversations to study word-of-mouth communications”, Marketing Science, Vol. 23 No. 4, pp. 545-560.

Griffin, R.J., Neuwirth, K., Giese, J. and Dunwoody, S. (2002), “Linking the heuristic-systematic model and depth of processing”, Communication Research, Vol. 29 No. 6, pp. 705-732.

Gupta, P. and Harris, J. (2010), “How e-WOM recommendations influence product consideration and quality of choice: “motivation to process information perspective”, Journal of Business Research, Vol. 63 No. 9, pp. 1041-1049.

He, W., Tian, X., Tao, R., Zhang, W., Yan, G. and Akula, V. (2017), “Application of social media analytics: a case of analyzing online hotel reviews”, Online Information Review, Vol. 41 No. 7, pp. 921-935.

Huang, A.H., Chen, K., Yen, D.C. and Tran, T.P. (2015), “A study of factors that contribute to online review helpfulness”, Computers in Human Behavior, Vol. 48 No. C, pp. 17-27.

Hunnicutt, S. and Carlberger, J. (2001), “Improving word prediction using Markov models and heuristic methods”, Augmentative and Alternative Communication, Vol. 17 No. 4, pp. 255-264.

Jeong, H.-J. and Koo, D.-M. (2015), “Combined effects of valence and attributes of e-WOM on consumer judgment for message and product”, Internet Research, Vol. 25 No. 1, pp. 2-29.

Korfiatis, N., Rodríguez, D. and Sicilia, M.A. (2008), “The impact of readability on the usefulness of online product reviews: a case study on an online bookstore”, in Lytras, M.D., Carroll, J.M., Damiani, E. and Tennyson, R.D. (Eds), World Summit on the Knowledge Society: Emerging Technologies and Information Systems for the Knowledge Society, Springer-Verlag, Berlin, pp. 423-432.

Korfiatis, N., García-Bariocanal, E. and Sánchez-Alonso, S. (2012), “Evaluating content quality and helpfulness of online product reviews: the interplay of review helpfulness vs review content”, Electronic Commerce Research and Applications, Vol. 11 No. 3, pp. 205-217.

Lampe, C., Johnston, E.W. and Resnick, P. (2007), “Follow the reader: filtering comments on Slashdot”, Proceedings of the 2007 Conference on Human Factors in Computing Systems, CHI 2007, San Jose, California, USA, April 28 – May 3, 2007, DBLP.

Lan, Q., Ma, H. and Li, G. (2018), “Characters-based sentiment identification method for short and informal Chinese text”, Information Discovery and Delivery, Vol. 46 No. 1, pp. 57-66.

Lee, J. and Lee, J.N. (2009), “Understanding the product information inference process in electronic word-of-mouth: an objectivity–subjectivity dichotomy perspective”, Information and Management, Vol. 46 No. 5, pp. 302-311.

Lee, G. and Xia, W. (2011), “A longitudinal experimental study on the interaction effects of persuasion quality, user training, and first-hand use on user perceptions of new information technology”, Information and Management, Vol. 48 No. 7, pp. 288-295.

Lee, Y.J., Hosanagar, K. and Tan, Y. (2015), “Do i follow my friends or the crowd? Information cascades in online movie ratings”, Social Science Electronic Publishing, Vol. 61 No. 9, pp. 2241-2258.

Liu, Z. and Park, S. (2015), “What makes a useful online review? Implication for travel product websites”, Tourism Management, Vol. 47 No. 47, pp. 140-151.

López-López, I. and Parra, J.F. (2016), “Is a most helpful eWOM review really helpful? The impact of conflicting aggregate valence and consumer’s goals on product attitude”, Internet Research, Vol. 26 No. 4, pp. 827-844.

Metzger, M.J., Flanagin, A.J. and Medders, R.B. (2010), “Social and heuristic approaches to credibility evaluation online”, Journal of Communication, Vol. 60 No. 3, pp. 413-439.

Moe, W.W. and Trusov, M. (2011), “Measuring the value of social dynamics in online product ratings forums”, Journal of Marketing Research, Vol. 48 No. 3, pp. 444-456.

Mudambi, S.M. and Schuff, D. (2010), “What makes a helpful online review? A study of customer reviews on amazon.com”, Society for Information Management and the Management Information Systems Research Center, Vol. 34 No. 1, pp. 185-200.

Ngo-Ye, T.L., Sinha, A.P. and Sen, A. (2017), “Predicting the helpfulness of online reviews using a scripts-enriched text regression model”, Expert Systems with Applications, Vol. 71, pp. 98-110.

Otterbacher, J. (2009), “Helpfulness in online communities: a measure of message quality”, Proceedings of the 27th International Conference on Human Factors in Computing Systems, New York, ACM, pp. 955-964.

Petty, R.E., Wells, G.L., Heesacker, M., Brock, T.C. and Cacioppo, J.T. (1983), “The effects of recipient posture on persuasion: a cognitive response analysis”, Personality and Social Psychology Bulletin, Vol. 9 No. 2, pp. 209-222.

Qiu, L. and Li, D. (2010), “Effects of aggregate rating on eWOM acceptance: an Attribution Theory perspective”, PACIS 2010 Proceedings, Paper No. 147, Taipei, July 9-12.

Schlosser, A.E. (2005), “Posting versus lurking: communicating in a multiple audience context”, Journal of Consumer Research, Vol. 32 No. 2, pp. 260-265.

Sparks, B.A., Perkins, H.E. and Buckley, R. (2013), “Online travel reviews as persuasive communication: the effects of content type, source, and certification logos on consumer behavior”, Tourism Management, Vol. 39 No. 2, pp. 1-9.

Tam, K.Y. and Ho, S.Y. (2005), “Web personalization as a persuasion strategy: an elaboration likelihood model perspective”, Information Systems Research, Vol. 16 No. 3, pp. 271-291.

Taylor, S.E., Fiske, S.T., Etcoff, N.L. and Ruderman, A.J. (1978), “Categorical and contextual bases of person memory and stereotyping”, Journal of Personality and Social Psychology, Vol. 36 No. 7, pp. 778-793.

Tirunillai, S. and Tellis, G.J. (2012), “Does chatter really matter? Dynamics of user-generated content and stock performance”, Marketing Science, Vol. 31 No. 2, pp. 198-215.

Todorov, A., Chaiken, S. and Henderson, M.D. (2002), “The heuristic-systematic model of social information processing”, The Persuasion Handbook: Developments in Theory and Practice, pp. 195-211.

Tversky, A. and Kahneman, D. (1974), “Judgment under uncertainty: heuristics and biases”, Science, Vol. 185 No. 4157, pp. 1124-1131.

Walther, J.B., Liang, Y., Ganster, T., Wohn, D.Y. and Emington, J. (2012), “Online reviews, helpfulness ratings, and consumer attitudes: an extension of congruity theory to multiple sources in web 2.0”, Journal of Computer-Mediated Communication, Vol. 18 No. 1, pp. 97-112.

Wang, R.Y. and Strong, D.M. (1996), “Beyond accuracy: what data quality means to data consumers”, Journal of Management Information Systems, Vol. 12 No. 4, pp. 5-33.

Willemsen, L.M., Neijens, P.C., Bronner, F. and De Ridder, J.A. (2011), “‘Highly recommended!’ the content characteristics and perceived usefulness of online consumer reviews”, Journal of Computer-Mediated Communication, Vol. 17 No. 1, pp. 19-38.

Yang, S.-B., Shin, S.-H., Joun, Y. and Koo, C. (2016), “Exploring the comparative importance of online hotel reviews’ heuristic attributes in review helpfulness: a conjoint analysis approach”, Journal of Travel and Tourism Marketing, Vol. 34 No. 7, pp. 963-985.

Yin, R. (2002), Case Study: Research Design and Methods, Sage Publication, New Delhi.

Zhang, R. and Tran, T. (2010), “Helpful or unhelpful: a linear approach for ranking product reviews”, Journal of Electronic Commerce Research, Vol. 11 No. 3, pp. 220-230.

Zhang, W. and Watts, S. (2008), “Capitalizing on content: information adoption in two online communities”, Journal of the Association for Information Systems, Vol. 9 No. 2, pp. 73-94.

Zhang, K.Z.K., Zhao, S.J., Cheung, C.M.K. and Lee, M.K.O. (2014), “Examining the influence of online reviews on consumers’ decision-making: a heuristic–systematic model”, Decision Support Systems, Vol. 67, pp. 78-89.

Qiu C, Popkowski Leszczyc P., (2016), Send-for-review decisions, brand equity, and pricing, European Journal of Marketing, 2016-02-08, Vol.50 (1/2), p.145-165

Mots-clefs : avis en ligne, intermédiaires, experts, prix, qualité, confiance, bouche à oreille sur internet

Résumé : Cet article a pour but de d’étudier les décisions des entreprises d’envoyer ou non leurs produits à une évaluation de qualité au près d’une société intermédiaire, experte en la matière. Ces avis s’opposant ainsi aux avis des consommateurs, ne pouvant être considérés comme des avis professionnels.
Ces examens professionnels ont selon l’auteur une influence importante sur le futur prix du produit mais également sur la perception des consommateurs et sur leurs prochains avis.
Selon l’étude les marques dites “faibles” ont plus tendances à envoyer en examen leurs produits de qualité. Ces examens permettent de diminuer les écarts de prix entre marque “faibles” et marques “fortes”, plus l’exam sera positif plus le prix le sera aussi. Ces examens permettent également de développer d’avantage le bouche à oreille sur internet, mettant davantage le consommateur en confiance.

Cette étude met également en avant le fait que les avis d’experts sont plus considérés par les consommateurs car il s’agit d’avis professionnels et donc plus objectifs. Cependant l’auteur indique également que ces avis d’expert influencent aussi les futurs avis des consommateurs, comparant ainsi leur point de vue et expérience à celui-ci. Les deux avis peuvent ainsi se compléter ou s’opposer.

Conclusion :

L’étude permet de définir les raisons pour lesquelles une entreprise envoie ou non un produit à un intermédiaire pour que celui-ci l’évalue. La première est liée au prix, plus un produit sera évalué, par un expert, positivement, plus son prix sera susceptible d’augmenter.
Ces avis d’intermédiaires s’opposent ainsi ou se comparent aux avis d’utilisateurs.
L’importance portée par les consommateurs à ces avis d’experts dépend souvent de la confiance. L’auteur termine l’étude en indiquant que le bouche à oreille sur internet est devenu essentiel et vit une période tourmentée liée aux scandales des faux avis en ligne. Les avis d’experts et d’intermédiaires pourraient être une solution car celles-ci sont impartiales et réalisées par des sociétés tierces indépendantes.

Sources de l’auteur :

Aaker, D.A. (1996), “Measuring brand equity across products and markets”, California Management Review , Vol. 38 No. 3, p. 103.

Ailawadi, K.L. , Lehmann, D.R. and Neslin, S.A. (2003), “Revenue premium as an outcome measure of brand equity”, Journal of Marketing , Vol. 67 No. 4, pp. 1-17.

Brynjolfsson, E. and Smith, M.D. (2000), “Frictionless commerce? A comparison of internet and conventional retailers”, Management Science , Vol. 46 No. 4, pp. 563-585.

Chen, H.-N. and Huang, C.-Y. (2013), “An investigation into online reviewers’ behavior”, European Journal of Marketing , Vol. 47 No. 10, pp. 1758-1773.

Chen, Y. and Xie, J. (2008), “Online consumer review: word-of-mouth as a new element of marketing communication mix”, Management Science , Vol. 54 No. 3, pp. 477-491.

Chevalier, J. and Mayzlin, D. (2006), “The effect of word of mouth online: online book reviews”, Journal of Marketing Research , Vol. 43 No. 3, pp. 345-354.

Chu, W.J. and Chu, W. (1994), “Signaling quality by selling through a reputable retailer – an example of renting the reputation of another agent”, Marketing Science , Vol. 13 No. 2, pp. 177-189.

Curry, D.J. and Riesz, P.C. (1988), “Prices and price/quality relationships: a longitudinal analysis”, The Journal of Marketing , Vol. 52 No. 1, pp. 36-51.

Daughety, A.F. and Reinganum, J.F. (2008), “Communicating quality: a unified model of disclosure and signaling”, Rand Journal of Economics , Vol. 39 No. 4, pp. 973-989.

Dellarocas, C. , Zhang, X. and Awad, N. (2007), “Exploring the value of online product reviews in forecasting sales: the case of motion pictures”, Journal of Interactive Marketing , Vol. 21 No. 4, pp. 23-45.

Du, N. , Huang, H. and Li, L.I. (2013), “Can online trading survive bad-mouthing? An experimental investigation”, Decision Support Systems , Vol. 56, pp. 419-426.

Duan, W. , Gu, B. and Whinston, A.B. (2008), “Do online reviews matter? – An empirical investigation of panel data”, Decision Support Systems , Vol. 45 No. 4, pp. 1007-1016.

Eliashberg, J. and Shugan, S.M. (1997), “Film critics: influencers or predictors?”, Journal of Marketing , Vol. 60 No. 2, pp. 68-78.

Erdem, T. and Swait, J. (1998), “Brand equity as a signaling phenomenon”, Journal of Consumer Psychology , Vol. 7 No. 2, pp. 131-157.

Fishman, M.J. and Hagerty, K.M. (2003), “Mandatory versus voluntary disclosure in markets with informed and uninformed customers”, Journal of Law Economics & Organization , Vol. 19 No. 1, pp. 45-63.

Fung, A. , Graham, M. and Weil, D. (2007), Full Disclosure: The Perils and Promise of Transparency , Cambridge University Press, Cambridge.

Grossman, S.J. (1981), “The informational role of warranties and private disclosure about product quality”, Journal of Law & Economics , Vol. 24 No. 3, pp. 461-483.

Guo, L. and Zhao, Y. (2009), “Voluntary quality disclosure and market interaction”, Marketing Science , Vol. 28 No. 3, pp. 488-501.

Helft, M. (2010), “On new iphone, a mystery of dropped calls”, New York Times , 24 June.

Helft, M. and Holson, L.M. (2008), “With google phone, htc comes out of the shadows”, New York Times , 22 September.

Ho-Dac, N.-N. , Carson, S.J. and Moore, W.L. (2011), “Relationships among brand equity, customer reviews, and sales response in an online selling environment”, Working Paper, School of Business, University of Utah.

International Data Corporation (2004), 2004 US Camcorder Owner Demographic Survey , IDC.

J.D. Power & Associates (2006), 2005 Market Share Reports by Category , J.D. Power & Associates.

Kamakura, W.A. and Russell, G.J. (1993), “Measuring brand value with scanner data”, International Journal of Research in Marketing , Vol. 10 No. 1, pp. 9-22.

Lichtenstein, D.R. and Burton, S. (1989), “The relationship between perceived and objective price-quality”, Journal of Marketing Research , Vol. 26 No. 4, pp. 429-443.

Liu, Y. (2006), “Word of mouth for movies: its dynamics and impact on box office revenue”, Journal of Marketing , Vol. 70 No. 3, pp. 74-89.

Mayzlin, D. , Dover, Y. and Chevalier, J.A. (2014), “Promotional reviews: an empirical investigation of online review manipulation”, American Economic Review , Vol. 104 No. 8, pp. 2421-2455.

Milgrom, P.R. (1981), “Good news and bad news: Representation theorems and applications”, The Bell Journal of Economics , Vol. 12 No. 2, pp. 380-391.

Moon, S. , Park, Y. and Kim, Y.S. (2014), “The impact of text product reviews on sales”, European Journal of Marketing , Vol. 48 Nos 11/12, pp. 2176-2197.

NPD Group (2006), 2005 Market Share Reports , NPD.

Patara, Y. and Monroe, K. (2008), “The effects of certification cobrand and price on consumers’ product evaluations and purchase intentions”, The University of Illinois:. PhD. Dissertation.

Pinch, T. and Kesler, F. (2011), “How aunt ammy gets her free lunch: a study of the top-thousand customer reviewers at amazon.com ”, Working Paper, Department of Science and Technology Studies, Cornell University.

Rao, A.R. and Monroe, K.B. (1989), “The effect of price, brand name, and store name on buyers’ perceptions of product quality: an integrative review”, Journal of Marketing Research , Vol. 26 No. 3, pp. 351-357.

Rosen, S. (1974), “Hedonic prices and implicit markets: product differentiation in pure competition”, Journal of Political Economy , Vol. 82 No. 1, pp. 34-55.

Senecal, S. and Nantel, J. (2004), “The influence of online product recommendations on consumers’ online choices”, Journal of Retailing , Vol. 80 No. 2, pp. 159-169.

Smith, D. , Menon, S. and Sivakumar, K. (2005), “Online peer and editorial recommendations, trust, and choice in virtual markets”, Journal of Interactive Marketing , Vol. 19 No. 3, pp. 15-38.

Swait, J. and Erdem, T. (2007), “Brand effects on choice and choice set formation under uncertainty”, Marketing Science , Vol. 26 No. 5, pp. 679-697.

Wernerfelt, B. (1988), “Umbrella branding as a signal of new product quality: an example of signalling by posting a bond”, Rand Journal of Economics , Vol. 19 No. 3, pp. 458-466.

Zeithaml, V.A. (1988), “Consumer perceptions of price, quality, and value – a means-end model and synthesis of evidence”, Journal of Marketing , Vol. 52 No. 3, pp. 2-22.

Zhang, L., Ma, B. and Cartwright, D.K. (2013), “The impact of online user reviews on cameras sales”, European Journal of Marketing , Vol. 47 No. 7, pp. 1115-1128.

Zhu, F. and Zhang, X.M. (2010), “Impact of online consumer reviews on sales: the moderating role of product and consumer characteristics”, Journal of Marketing , Vol. 74 No. 2, pp. 133-148.

O’Reilly K., MacMillan A., Alhassan M., Lancendorfer K., (2018), Factors affecting consumers’ online product review use, Qualitative Market Research, Vol. 21

Mots-clefs : facteur, bouche à oreille électronique, décision d’achat, frein, avis en ligne, motivation de la prise de décision.

Résumé : Cet article a pour but d’évaluer et définir les facteurs qui influencent l’utilisation du “bouche à oreille électronique” sur la décision d’achat ainsi que les éléments de motivation d’un consommateur à prendre en compte les avis en ligne de produits.

L’auteur définit au cours de son étude deux raisons d’utilisation des avis en ligne par les consommateurs.
La première est selon lui “la motivation de la prise de décision”. Cette impulsion est un élan mental qui apparait lorsque un ou plusieurs éléments améliorent l’avant prise de décision. Cet élan permettre l’accélération de la prise de décision d’achat d’un produit, raccourcissant ainsi le temps de recherche et récolte d’informations, d’avis sur le produit.
La deuxième est, toujours selon l’auteur, “le frein de prise de décision”. Il s’agit cette fois d’une résistance mentale due lorsque un ou plusieurs éléments entravent la prise de décision. Cet effet ralentira ainsi la décision d’achat en allongeant logiquement la phase de rechercher d’avis supplémentaires.

L’auteur indique que son étude est la première à définir et identifier la motivation et le frein de prise de décision come révélateur dans la recherche d’avis produit par le consommateur. Ces mécanismes pourraient permettre aux marketeurs et entreprises de mieux comprendre les consommateurs et l’importance qu’ils donnent ou non aux avis produits.

Il définit quatre facteurs améliorant la prise de décision : le désir du consommateur pour le produit, le besoin du produit, la préférence pour la marque, la familiarité avec le produit et/ou la marque.

Il définit également quatre facteurs freins : culpabilité par rapport à un gaspillage par exemple, incertitude quant au besoin, le prix, méconnaissance du produit/marque.

Conclusion : Cet article permet d’identifier certaines raison de la prise de décision d’achat rapide ou ralentie ainsi que les raisons qui poussent le consommateur à rechercher et croire les avis en ligne.
Les analyses de données de l’auteur permettent de dire que les consommateurs prennent en compte les avis produits car ils souhaitent faire le bon choix et pensent que ces avis sont révélateurs, car ils veulent gagner du temps dans leur prise de décision, ils veulent restreindre les choix possibles au plus vite pour comparer les offres produits
L’étude définit également les raisons pour lesquelles un consommateur va s’engager dans une recherche supplémentaire et plus poussée d’avis en ligne de produits. L’auteur indique que selon ses analyses un consommateur décide de rechercher des avis en plus selon le contexte, la présence de certains facteurs améliorant ou freinant la prise de décision : par exemple le prix, le type de produit et si le besoin du produit est immédiat ou non.

Sources de l’auteur :

Abrams, L.S. (2010), “Sampling ‘hard to reach’ populations in qualitative research”, Qualitative Social Work: Research and Practice, Vol. 9 No. 4, pp. 536-550.

Awad, N.F. and Ragowsky, A. (2008), “Establishing trust in electronic commerce through online word of mouth: an examination across genders”, Journal of Management Information Systems, Vol. 24 No. 4, pp. 101-121.

Bae, S. and Lee, T. (2011), “Gender differences in consumers’ perception of online consumer reviews”, Electronic Commerce Research, Vol. 11 No. 2, pp. 201-214.

Bettman, J.R. (1973), “Perceived risk and its components”, Journal of Marketing Research, Vol. 10 No. 2, pp. 182-190.

Charmaz, K. (2005), “Grounded theory in the 21st century. Applications for advancing social justice studies”, in Denzin, N. and Lincoln, Y. (Eds), Handbook of Qualitative Research, 3rd ed., Sage, Thousand Oaks, CA, pp. 507-535.

Chatterjee, P. (2001), “Online reviews – do consumers use them?”, in Gilly, M.C. and Myers-Levy, J. (Eds), ACR 2001 Proceedings, Association for Consumer Research, Provo, UT, pp. 129-134.

Cheung, C.M.K. and Thadani, D.R. (2012), “The impact of electronic word-of-mouth communication: a literature analysis and integrative model”, Decision Support Systems, Vol. 54 No. 1, pp. 461-470.

Cheung, C.M.K., Lee, M.K.O. and Rabjohn, N. (2008), “The impact of electronic word-of-mouth. The adoption of online opinions in online customer communities”, Internet Research, Vol. 18 No. 3, pp. 229-247.

Cheung, C.M.K., Lee, M.K.O. and Thadani, D.R. (2009), “The impact of positive electronic word-of-mouth on consumer online purchasing decision”, in Lytras, M.D., Damiani, E., Carroll, J.M., Tennyson, R.D., Avison, D., Naeve, A., Dales, A., Lefrere, P., Tan, F., Sipior, J. and Vossen, G. (Eds), Lecture Notes in Computer Science, Springer-Verlag, Berlin Heidelberg, Vol. 5736, pp. 501-510.

Chevalier, J. and Mayzlin, D. (2006), “The effect of word of mouth on sales: online book reviews”, Journal of Marketing Research, Vol. 43 No. 3, pp. 345-354.

Dabholkar, P.A. (2006), “Factors influencing consumer choice of a rating web site: an experimental investigation of an online interactive decision aid”, Journal of Marketing Theory and Practice, Vol. 14 No. 4, pp. 259-273.

Dellarocas, C., Zhang, X. and Awad, N.F. (2007), “Exploring the value of online product reviews in forecasting sales: the case of motion pictures”, Journal of Interactive Marketing, Vol. 21 No. 4, pp. 23-45.

Dhar, R. and Nowlis, S.M. (1999), “The effect of time pressure on consumer choice deferral”, Journal of Consumer Research, Vol. 25 No. 4, pp. 369-384.

Doh, S.J. and Hwang, J.S. (2009), “Rapid communication. How consumers evaluate eWOM (electronic word-of-mouth) messages”, CyberPsychology and Behavior, Vol. 12 No. 2, pp. 193-197.

Dowling, G.R. (1986), “Perceived risk: the concept and its measurement”, Psychology and Marketing, Vol. 3 No. 3, pp. 193-210.

eMarketer (2018), “Level of trust in online reviews according to US internet users in August 2012”, In Statista – The Statistics Portal

Estabrook, L., Witt, E. and Rainie, L. (2007), “Information searches that solve problems”, Pew/Internet and American Life Project, 30 December 2007

Fan, Y. and Miao, Y. (2012), “Effect of electronic word-of-mouth on consumer purchase intention: the perspective of gender differences”, International Journal of Electronic Business Management, Vol. 10 No. 3, pp. 175-181.

Filieri, R. (2015), “What makes online reviews helpful? A diagnosticity-adoption framework to explain informational and normative influences in e-WOM”, Journal of Business Research, Vol. 68 No. 6, pp. 1261-1270.

Garbarino, E. and Strahilevitz, M. (2004), “Gender differences in the perceived risk of buying online and the effects of receiving a site recommendation”, Journal of Business Research, Vol. 57 No. 7, pp. 768-775.

Glaser, B.G. and Strauss, A.L. (1967), The Discovery of Grounded Theory, Aldine De Gruyter, Hawthorne, NY.

Glesne, C. (2006), Becoming Qualitative Researchers, 3rd ed., Pearson Education, Boston.

Goldsmith, R.E. and Horowitz, D. (2006), “Measuring motivations for online opinion seeking”, Journal of Interactive Advertising, Vol. 6 No. 2, pp. 1-16.

Gottschalk, S.A. and Mafael, A. (2017), “Cutting through the online review jungle – investigating selective eWOM processing”, Journal of Interactive Marketing, Vol. 37 February, pp. 89-104.

Greenleaf, E.A. and Lehmann, D.R. (1995), “Reasons for substantial delay in consumer decision making”, Journal of Consumer Research, Vol. 22 No. 2, pp. 186-199.

Gupta, P. and Harris, J. (2010), “How e-WOM recommendations influence product consideration and quality of choice: a motivation to process information perspective”, Journal of Business Research, Vol. 63 Nos 9/10, pp. 1041-1049.

Gvili, Y. and Levy, S. (2016), “Antecedents of attitudes toward eWOM communication: differences across channels”, Internet Research, Vol. 26 No. 5, pp. 1030-1051.

Hasan, B. (2010), “Exploring gender differences in online shopping attitude”, Computers in Human Behavior, Vol. 26 No. 4, pp. 597-601.

Hennig-Thurau, T. and Walsh, G. (2003), “Electronic word-of-mouth: motives for and consequences of reading customer articulations on the internet”, International Journal of Electronic Commerce, Vol. 8 No. 2, pp. 51-74.

Hennig-Thurau, T., Gwinner, K.P., Walsh, G. and Gremler, D.D. (2004), “Electronic word-of-mouth via consumer-opinion platforms: what motivates consumers to articulate themselves on the internet?”, Journal of Interactive Marketing, Vol. 18 No. 1, pp. 38-52.

Hoyer, W.D., MacInnish, D.J. and Pieters, R. (2013), Consumer Behavior, Southwestern Cengage Learning, Mason, OH.

Huang, J.H. and Chen, Y.F. (2006), “Herding in online product choice”, Psychology and Marketing, Vol. 23 No. 5, pp. 413-428.

Janda, S. (2008), “Does gender moderate the effect of online concerns on purchase likelihood?”, Journal of Internet Commerce, Vol. 7 No. 3, pp. 339-358.

Kiecker, P. and Cowles, D. (2001), “Interpersonal communication and personal influence on the internet: a framework for examining online word-of-mouth”, Journal of Euromarketing, Vol. 11 No. 2, pp. 71-88.

Kim, E.E.K., Mattila, A.S. and Baloglu, S. (2011), “Effects of gender and expertise on consumers’ motivation to read online hotel reviews”, Cornell Hospitality Quarterly, Vol. 52 No. 4, pp. 399-406.

King, R.A., Racherla, P. and Bush, V.D. (2014), “What we know and don’t know about online word-of-mouth: a review and synthesis of the literature”, Journal of Interactive Marketing, Vol. 28 No. 3, pp. 167-183.

Koerber, A. and McMichael, L. (2008), “Qualitative sampling methods: a primer for technical communicators”, Journal of Business and Technical Communication, Vol. 22 No. 4, pp. 454-473.

Kozinets, R., de Valck, K., Wojnicki, S. and Wilner, S. (2010), “Networked narratives: understanding word-of-mouth marketing in online communities”, Journal of Marketing, Vol. 74 No. 2, pp. 71-89.

Kwok, L., Xie, K.L. and Richards, T. (2017), “Thematic framework of online review research. A systematic analysis of contemporary literature on seven major hospitality and tourism journals”, International Journal of Contemporary Hospitality Management, Vol. 29 No. 1, pp. 307-354.

Lee, E.-J. and Shin, S.Y. (2014), “When do consumers buy online product reviews? Effects of review quality, product type, and reviewer’s photo”, Computers in Human Behavior, Vol. 31 February, pp. 356-366.

Liu, Q., Karahanna, E. and Watson, R.T. (2011), “Unveiling user-generated content: designing websites to best present customer reviews”, Business Horizons, Vol. 54 No. 3, pp. 231-240.

McKnight, H. and Kacmar, C. (2006), “Factors of information credibility for an internet advice site”, Proceedings of the 39th Hawaii International Conference on System Sciences, IEEE, Kauia, HI.

McQuarrie, E.F. and Munson, J.M. (1992), “A revised product involvement inventory: improved usability and validity”, Advances in Consumer Research, Vol. 19 No. 1, pp. 108-115.

Mackiewicz, J. and Yeats, D. (2014), “Product review users’ perceptions of review quality: the role of credibility, informativeness, and readability”, IEEE Transactions on Professional Communication, Vol. 57 No. 4, pp. 309-324.

Martin, W. and Lueg, J. (2013), “Modeling word-of-mouth usage”, Journal of Business Research, Vol. 66 No. 7, pp. 801-808.

Metzger, M.J. (2007), “Making sense of credibility on the web: models for evaluating online information and recommendations for future research”, Journal of the American Society for Information Science and Technology, Vol. 58 No. 13, pp. 2078-2091.

Meyers-Levy, J. and Maheswaran, D. (1991), “Exploring differences in males’ and females’ processing strategies”, Journal of Consumer Research, Vol. 18 No. 1, pp. 63-70.

Miles, M.B. and Huberman, A.M. (1994), Qualitative Data Analysis: An Expanded Sourcebook, Sage Publications, Thousand Oaks.

Mitchell, V.-W. (1999), “Consumer perceived risk: conceptualisations and models”, European Journal of Marketing, Vol. 33 Nos 1/2, pp. 163-195.

Mudambi, S.M. and Schuff, D. (2010), “What makes a helpful online review? A study of customer reviews on Amazon.com”, MIS Quarterly, Vol. 34 No. 1, pp. 185-200.

Nielsen Scarborough (2018) “Online activities: number of internet users who accessed consumer reviews (products, services, etc.) within the last month in the United States (USA) from autumn 2010 to spring 2014 (in millions)”, In Statista – The Statistics Portal

O’Reilly, K. and Marx, S. (2011), “How young, technical consumers assess online WOM credibility”, Qualitative Market Research: An International Journal, Vol. 14 No. 4, pp. 330-359.

Park, C. and Lee, T. (2009), “Information direction, website reputation and eWOM effect: a moderating role of product type”, Journal of Business Research, Vol. 62 No. 1, pp. 61-67.

Park, D.H. and Lee, J. (2008), “eWOM overload and its effect on consumer behavioral intention depending on consumer involvement”, Electronic Commerce Research and Applications, Vol. 7 No. 4, pp. 386-398.

Park, D.H., Lee, J. and Han, I. (2007), “The effect of on-line consumer reviews on consumer purchasing intention: the moderating role of involvement”, International Journal of Electronic Commerce, Vol. 11 No. 4, pp. 125-148.

Park, D. and Kim, S. (2008), “The effects of consumer knowledge on message processing of electronic word-of-mouth via online consumer reviews”, Electronic Commerce Research and Applications, Vol. 7 No. 4, pp. 399-410.

Patton, M.Q. (2002), “Two decades of developments in qualitative inquiry: a personal, experiential perspective”, Qualitative Social Work: Research and Practice, Vol. 1 No. 3, pp. 261-283.

Pew Research Center (2014), “Internet user demographics”, 

Pew Research Center (2015), “Online Reviews”

Prensky, M. (2001), “Digital natives, digital immigrants”, On the Horizon, Vol. 9 No. 5, p. 106.

Ruane, L. and Wallace, E. (2013), “Generation Y females online: insights from Brand narratives”, Qualitative Market Research: An International Journal, Vol. 16 No. 3, pp. 315-335.

Schiffman, L.G. and Wisenblit, J. (2015), Consumer Behavior, 11th ed., Pearson.

Seale, C. and Silverman, D. (1997), “Ensuring rigour in qualitative research”, European Journal of Public Health, Vol. 7 No. 4, pp. 379-384.

Shenton, A.K. (2004), “Strategies for ensuring trustworthiness in qualitative research projects”, Education for Information, Vol. 22 No. 2, pp. 63-75.

Sher, P.J. and Lee, S.H. (2009), “Consumer skepticism and online reviews: an elaboration likelihood model perspective”, Social Behavior and Personality: An International Journal, Vol. 37 No. 1, pp. 137-144.

Strauss, A. and Corbin, J. (1990), Basics of Qualitative Research: Grounded Theory Procedures and Techniques, Sage Publications, Newbury Park, CA.

Zaichkowsky, J.L. (1985), “Measuring the involvement construct”, Journal of Consumer Research, Vol. 12, pp. 341-352.

Zhang, K.Z.K., Cheung, C.M.K. and Lee, M.K.O. (2014), “Examining the moderating effect of inconsistent reviews and its gender differences on consumers’ online shopping decision”, International Journal of Information Management, Vol. 34 No. 2, pp. 89-98.

Zhang, W. and Watts, S.A. (2008), “Capitalizing on content: information adoption in two online communities”, Journal of the Association for Information Systems, Vol. 9 No. 2, pp. 73-94.

Zhu, F. and Zhang, X.M. (2010), “Impact of online consumer reviews on sales: the moderating role of product and consumer characteristics”, Journal of Marketing, Vol. 74 No. 2, pp. 133-148.

Munzel A, (2015), Attention aux faux avis! Investigations expérimentales sur les indicateurs contextuels facilitant la détection des avis trompeurs par les internautes, Recherche et Applications en Marketing, Vol. 30, p25-p53. 

Mots-clefs : avis d’internautes, algorithmes, bouche à oreille électronique, contexte, consensus, crédibilité, faux avis.

Résumé : Cette étude a pour but de compléter la recherche déjà existante dans le cadre de la traque des faux avis en ligne en s’intéressant au développement d’indicateurs potentiels de communication trompeuse en ligne mais également des mécanismes de soutien à la détection de ces pratiques.

Selon l’auteur, un lecteur des avis familiarisé réagit plus violemment que les autres utilisateurs à des lacunes du site concernant ses capacités à détecter les faux avis. Il souligne que plus le récepteur est familiarisé avec les avis en ligne et leur utilisation, plus il considère la source de l’avis comme crédible.

Cette étude soutien donc la pertinence de deux mécanismes de soutien à la détection de faux avis par les internautes : le label attribué par une institution tierce et les capacités du site à identifier et supprimer les avis trompeurs. Selon l’auteur, la vérification des avis par une entité indépendante rend l’avis plus crédible pour le récepteur.

Selon une analyse de l’auteur, plus une personne est âgée et expérimentée dans le domaine des avis plus elle prendra en compte l’évaluation faite par l’institution en charge d’évaluer la crédibilité.

Conclusion : Selon l’auteur les algorithmes mis en place se concentrent trop sur une détection automatique du contenu du faux avis, du texte et des écris en lui même. L’auteur pense que ces algorithmes n’apportent pas l’attention nécessaire au contexte d’un commentaire et/ou avis.

L’étude définit également que plus une personne est expérimentée dans le domaine des avis en ligne et plus elle est âgée, plus cette personne interprétera correctement un avis en ligne en parvenant à capter les indicateurs disponibles. Cette personne sera ainsi moins influencée par les communications trompeuses et frauduleuses.